Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W3XN72

Protein Details
Accession W3XN72    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
59-117ETTEPAKKTTKKTVKKTTKKKPTKKTTKAAAKPKKAKKVEKKKPATRKVKKPLSPEKEEBasic
NLS Segment(s)
PositionSequence
64-113AKKTTKKTVKKTTKKKPTKKTTKAAAKPKKAKKVEKKKPATRKVKKPLSP
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG pfy:PFICI_01213  -  
Pfam View protein in Pfam  
PF09011  HMG_box_2  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MFTNLGRAAVQRLPLRTIATSSVVSRLVSRAAPNQRGLAVLVSDLSRSGALRSFATKTETTEPAKKTTKKTVKKTTKKKPTKKTTKAAAKPKKAKKVEKKKPATRKVKKPLSPEKEEQLKIRELKMASLYYAESKAKVTKVKLPSTAYLLWISEKLKGNSRDALATQEAFTKVTNEWKTVSGSELAGLKRTAEANKLQNEANHKAWVESYTVEEIQRANRARQMLKRKFNYPAKRPVHLLKDDRRPLGVRSPFTYYVKARWASGDFENQTASSGIKTQSEEWKNLSAAEKAPYEELSRADRARRAREQSVLSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.3
4 0.3
5 0.26
6 0.25
7 0.24
8 0.22
9 0.23
10 0.22
11 0.21
12 0.2
13 0.19
14 0.18
15 0.18
16 0.2
17 0.26
18 0.34
19 0.38
20 0.39
21 0.4
22 0.37
23 0.36
24 0.34
25 0.26
26 0.18
27 0.13
28 0.12
29 0.1
30 0.1
31 0.09
32 0.09
33 0.08
34 0.08
35 0.09
36 0.11
37 0.13
38 0.14
39 0.17
40 0.19
41 0.2
42 0.24
43 0.24
44 0.25
45 0.28
46 0.32
47 0.34
48 0.4
49 0.4
50 0.43
51 0.51
52 0.53
53 0.54
54 0.6
55 0.65
56 0.68
57 0.76
58 0.79
59 0.82
60 0.87
61 0.91
62 0.91
63 0.92
64 0.93
65 0.94
66 0.93
67 0.94
68 0.94
69 0.93
70 0.91
71 0.91
72 0.9
73 0.89
74 0.89
75 0.88
76 0.87
77 0.88
78 0.87
79 0.87
80 0.85
81 0.86
82 0.86
83 0.88
84 0.88
85 0.88
86 0.9
87 0.9
88 0.92
89 0.92
90 0.92
91 0.91
92 0.91
93 0.91
94 0.9
95 0.86
96 0.85
97 0.85
98 0.82
99 0.79
100 0.71
101 0.68
102 0.66
103 0.62
104 0.55
105 0.48
106 0.46
107 0.4
108 0.38
109 0.34
110 0.26
111 0.26
112 0.26
113 0.22
114 0.17
115 0.16
116 0.15
117 0.12
118 0.14
119 0.13
120 0.11
121 0.11
122 0.14
123 0.16
124 0.19
125 0.2
126 0.25
127 0.31
128 0.34
129 0.37
130 0.37
131 0.36
132 0.36
133 0.35
134 0.29
135 0.23
136 0.19
137 0.15
138 0.15
139 0.14
140 0.15
141 0.18
142 0.17
143 0.23
144 0.25
145 0.27
146 0.28
147 0.28
148 0.24
149 0.21
150 0.23
151 0.17
152 0.15
153 0.13
154 0.13
155 0.12
156 0.12
157 0.11
158 0.1
159 0.1
160 0.17
161 0.18
162 0.17
163 0.18
164 0.19
165 0.2
166 0.19
167 0.2
168 0.13
169 0.12
170 0.12
171 0.14
172 0.12
173 0.12
174 0.12
175 0.11
176 0.11
177 0.13
178 0.13
179 0.13
180 0.18
181 0.22
182 0.25
183 0.27
184 0.27
185 0.27
186 0.33
187 0.34
188 0.31
189 0.28
190 0.25
191 0.23
192 0.23
193 0.22
194 0.17
195 0.13
196 0.13
197 0.13
198 0.14
199 0.13
200 0.14
201 0.13
202 0.14
203 0.21
204 0.21
205 0.2
206 0.22
207 0.27
208 0.31
209 0.39
210 0.48
211 0.51
212 0.58
213 0.62
214 0.63
215 0.68
216 0.73
217 0.75
218 0.71
219 0.72
220 0.68
221 0.66
222 0.66
223 0.64
224 0.62
225 0.6
226 0.6
227 0.58
228 0.63
229 0.66
230 0.63
231 0.59
232 0.53
233 0.48
234 0.49
235 0.47
236 0.4
237 0.37
238 0.43
239 0.44
240 0.45
241 0.47
242 0.4
243 0.38
244 0.42
245 0.4
246 0.34
247 0.33
248 0.32
249 0.31
250 0.32
251 0.36
252 0.3
253 0.3
254 0.3
255 0.26
256 0.25
257 0.22
258 0.19
259 0.11
260 0.13
261 0.14
262 0.15
263 0.18
264 0.2
265 0.3
266 0.34
267 0.36
268 0.36
269 0.39
270 0.37
271 0.37
272 0.36
273 0.29
274 0.27
275 0.29
276 0.27
277 0.24
278 0.25
279 0.24
280 0.24
281 0.23
282 0.24
283 0.25
284 0.29
285 0.31
286 0.34
287 0.39
288 0.44
289 0.51
290 0.57
291 0.59
292 0.6
293 0.63