Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WYI1

Protein Details
Accession W3WYI1   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-35AQLPRVVILPQRRPKQRRRGFVRAYAPDHydrophilic
260-305GDKDLRKQEKKATKQEKKWEKEDRKAEKRQLKHPEREPRERKIREYBasic
NLS Segment(s)
PositionSequence
22-24KQR
265-303RKQEKKATKQEKKWEKEDRKAEKRQLKHPEREPRERKIR
Subcellular Location(s) mito 15, mito_nucl 12.666, cyto_mito 9.666, nucl 9, cyto_nucl 6.666
Family & Domain DBs
KEGG pfy:PFICI_08687  -  
Amino Acid Sequences MGDSSTAAQLPRVVILPQRRPKQRRRGFVRAYAPDLMHCGIDQATFLDFIDGLNKAVSSSPLADTFNLSGAAVGAVPASVASFLPLTGMSIQVAASVYTEISSRKGQNSYLLKMNDELLRPRGLYCLVMAYDTNFRRDHMAQDLGPDPVALMLRTATNQSSSVREKIRSNDGVTGASSFPEAAELIFPDLKDDVLTRGESGTDDSEDSESRGSGSSFASRLVERAAAYNARQDLKSQVKFQRKNPTSLINPLLDPSAELGDKDLRKQEKKATKQEKKWEKEDRKAEKRQLKHPEREPRERKIREYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.28
3 0.38
4 0.46
5 0.55
6 0.64
7 0.71
8 0.81
9 0.86
10 0.86
11 0.86
12 0.87
13 0.88
14 0.85
15 0.86
16 0.86
17 0.8
18 0.75
19 0.68
20 0.58
21 0.48
22 0.43
23 0.34
24 0.25
25 0.19
26 0.15
27 0.12
28 0.11
29 0.11
30 0.08
31 0.08
32 0.08
33 0.08
34 0.08
35 0.07
36 0.07
37 0.09
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.09
44 0.1
45 0.1
46 0.11
47 0.12
48 0.14
49 0.15
50 0.15
51 0.16
52 0.16
53 0.15
54 0.13
55 0.11
56 0.09
57 0.08
58 0.08
59 0.06
60 0.05
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.06
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.09
89 0.12
90 0.14
91 0.17
92 0.19
93 0.19
94 0.27
95 0.31
96 0.32
97 0.34
98 0.33
99 0.3
100 0.29
101 0.31
102 0.25
103 0.22
104 0.21
105 0.17
106 0.17
107 0.17
108 0.16
109 0.15
110 0.13
111 0.12
112 0.1
113 0.1
114 0.09
115 0.09
116 0.08
117 0.09
118 0.15
119 0.15
120 0.18
121 0.16
122 0.17
123 0.2
124 0.21
125 0.22
126 0.19
127 0.21
128 0.18
129 0.21
130 0.21
131 0.17
132 0.16
133 0.14
134 0.09
135 0.07
136 0.07
137 0.05
138 0.04
139 0.04
140 0.05
141 0.05
142 0.06
143 0.06
144 0.07
145 0.08
146 0.09
147 0.13
148 0.15
149 0.19
150 0.21
151 0.23
152 0.25
153 0.27
154 0.33
155 0.32
156 0.31
157 0.3
158 0.28
159 0.26
160 0.24
161 0.22
162 0.15
163 0.12
164 0.1
165 0.07
166 0.06
167 0.06
168 0.05
169 0.04
170 0.04
171 0.04
172 0.06
173 0.07
174 0.07
175 0.07
176 0.07
177 0.07
178 0.07
179 0.08
180 0.08
181 0.09
182 0.09
183 0.09
184 0.09
185 0.09
186 0.09
187 0.1
188 0.09
189 0.08
190 0.08
191 0.09
192 0.1
193 0.1
194 0.11
195 0.09
196 0.08
197 0.08
198 0.08
199 0.08
200 0.08
201 0.09
202 0.11
203 0.11
204 0.12
205 0.13
206 0.12
207 0.13
208 0.13
209 0.13
210 0.11
211 0.12
212 0.14
213 0.15
214 0.15
215 0.19
216 0.21
217 0.21
218 0.21
219 0.21
220 0.26
221 0.33
222 0.37
223 0.4
224 0.46
225 0.54
226 0.6
227 0.66
228 0.7
229 0.64
230 0.66
231 0.62
232 0.62
233 0.55
234 0.56
235 0.53
236 0.43
237 0.4
238 0.35
239 0.32
240 0.23
241 0.2
242 0.14
243 0.13
244 0.11
245 0.1
246 0.12
247 0.18
248 0.19
249 0.22
250 0.29
251 0.34
252 0.39
253 0.44
254 0.52
255 0.56
256 0.64
257 0.72
258 0.76
259 0.78
260 0.84
261 0.9
262 0.9
263 0.87
264 0.87
265 0.87
266 0.86
267 0.85
268 0.86
269 0.87
270 0.86
271 0.88
272 0.89
273 0.87
274 0.85
275 0.84
276 0.85
277 0.84
278 0.84
279 0.84
280 0.85
281 0.85
282 0.89
283 0.86
284 0.85
285 0.86
286 0.83