Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JV74

Protein Details
Accession C4JV74    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-29GSNAPKKDTPTKNKSGHKAKGKAPHydrophilic
NLS Segment(s)
PositionSequence
17-26KNKSGHKAKG
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
KEGG ure:UREG_06466  -  
Amino Acid Sequences MAVTHGSNAPKKDTPTKNKSGHKAKGKAPTDFPIVFCQCCVSEFMFPKNMNKTCNNLQGSENACQNCARNKKSCSDFPDAMLEQVVEMMSAYDKWASTTNMTVKAAHEKSIITIAAAVSEELKVVLASMPKETVSREASSAMSAENIDLLIQMLETLKQIQKIQEATFTSVEAIRKSIEIKTSSTNGIGNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.71
4 0.75
5 0.79
6 0.84
7 0.84
8 0.83
9 0.83
10 0.81
11 0.79
12 0.8
13 0.76
14 0.71
15 0.65
16 0.6
17 0.56
18 0.5
19 0.45
20 0.42
21 0.4
22 0.35
23 0.3
24 0.28
25 0.21
26 0.21
27 0.21
28 0.15
29 0.19
30 0.21
31 0.25
32 0.29
33 0.3
34 0.34
35 0.41
36 0.42
37 0.4
38 0.4
39 0.43
40 0.43
41 0.51
42 0.47
43 0.4
44 0.38
45 0.39
46 0.4
47 0.36
48 0.34
49 0.25
50 0.25
51 0.24
52 0.25
53 0.27
54 0.31
55 0.33
56 0.36
57 0.38
58 0.45
59 0.49
60 0.53
61 0.52
62 0.51
63 0.48
64 0.42
65 0.45
66 0.38
67 0.32
68 0.26
69 0.19
70 0.12
71 0.11
72 0.09
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.05
82 0.07
83 0.08
84 0.08
85 0.11
86 0.13
87 0.16
88 0.17
89 0.17
90 0.16
91 0.23
92 0.23
93 0.21
94 0.19
95 0.16
96 0.16
97 0.18
98 0.17
99 0.09
100 0.09
101 0.07
102 0.07
103 0.07
104 0.06
105 0.05
106 0.05
107 0.05
108 0.04
109 0.04
110 0.03
111 0.04
112 0.05
113 0.06
114 0.07
115 0.08
116 0.09
117 0.09
118 0.1
119 0.11
120 0.14
121 0.16
122 0.16
123 0.16
124 0.17
125 0.17
126 0.17
127 0.16
128 0.12
129 0.09
130 0.08
131 0.07
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.06
143 0.09
144 0.11
145 0.14
146 0.16
147 0.19
148 0.24
149 0.27
150 0.27
151 0.3
152 0.31
153 0.32
154 0.3
155 0.28
156 0.24
157 0.24
158 0.25
159 0.19
160 0.18
161 0.15
162 0.16
163 0.17
164 0.19
165 0.22
166 0.23
167 0.25
168 0.29
169 0.32
170 0.32
171 0.32