Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JTQ3

Protein Details
Accession C4JTQ3   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
281-302PVESGRPKRTGKKRSYNDSSFVHydrophilic
323-347SEESGRGSAKKKRKKVTTLAFSPWVHydrophilic
NLS Segment(s)
PositionSequence
329-337GSAKKKRKK
Subcellular Location(s) nucl 14, cyto_nucl 12.333, cyto 9.5, mito_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG ure:UREG_05842  -  
Pfam View protein in Pfam  
PF08633  Rox3  
Amino Acid Sequences MSAQPGQQSAITAVNAFPTPASSVGGIAKDSQEPSEKGIRLSTEIEGAPGFTDADSGVSHTQHDQQRQQEETAGSNAEDEAMDIDRNEGISEHPKIAALQNDLGQAFHTCKTSYSISGPNPHFDLVSLYGLGPVAASVARTDPVTGEKINRLRKSYEGKIKGLGLSGRNKPVKHDPGAPGGLRQLTMWPEEEWQNQKVIGKDIKVAEPDSTLHKLYMRAMKMEPGPVPNNDYWEDVLGHEKPAKQSATVPQTKKAGDASAAGIIRQPGQANGTPMSTSISPVESGRPKRTGKKRSYNDSSFVGYGEGFPDDDMELDGSFYSNSEESGRGSAKKKRKKVTTLAFSPWVLLARLHLFDLKLMQMLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.12
5 0.1
6 0.12
7 0.12
8 0.13
9 0.11
10 0.12
11 0.15
12 0.16
13 0.15
14 0.15
15 0.16
16 0.17
17 0.18
18 0.19
19 0.22
20 0.22
21 0.26
22 0.33
23 0.32
24 0.31
25 0.33
26 0.32
27 0.29
28 0.31
29 0.27
30 0.22
31 0.21
32 0.21
33 0.17
34 0.16
35 0.13
36 0.11
37 0.1
38 0.06
39 0.07
40 0.06
41 0.07
42 0.07
43 0.09
44 0.1
45 0.11
46 0.12
47 0.13
48 0.21
49 0.26
50 0.32
51 0.36
52 0.41
53 0.47
54 0.49
55 0.48
56 0.45
57 0.41
58 0.36
59 0.32
60 0.26
61 0.2
62 0.17
63 0.16
64 0.12
65 0.1
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.08
72 0.07
73 0.08
74 0.08
75 0.07
76 0.08
77 0.13
78 0.16
79 0.16
80 0.16
81 0.16
82 0.17
83 0.19
84 0.21
85 0.18
86 0.18
87 0.18
88 0.2
89 0.2
90 0.19
91 0.17
92 0.14
93 0.13
94 0.13
95 0.13
96 0.11
97 0.12
98 0.16
99 0.17
100 0.18
101 0.2
102 0.25
103 0.26
104 0.34
105 0.35
106 0.33
107 0.33
108 0.31
109 0.27
110 0.21
111 0.2
112 0.14
113 0.14
114 0.12
115 0.1
116 0.1
117 0.1
118 0.09
119 0.06
120 0.04
121 0.04
122 0.03
123 0.03
124 0.04
125 0.04
126 0.05
127 0.05
128 0.06
129 0.06
130 0.08
131 0.1
132 0.11
133 0.12
134 0.18
135 0.25
136 0.32
137 0.35
138 0.35
139 0.35
140 0.4
141 0.45
142 0.48
143 0.5
144 0.47
145 0.45
146 0.45
147 0.44
148 0.38
149 0.33
150 0.27
151 0.21
152 0.22
153 0.24
154 0.29
155 0.32
156 0.31
157 0.33
158 0.4
159 0.42
160 0.39
161 0.42
162 0.37
163 0.38
164 0.41
165 0.37
166 0.29
167 0.25
168 0.22
169 0.16
170 0.14
171 0.1
172 0.09
173 0.1
174 0.1
175 0.09
176 0.11
177 0.13
178 0.16
179 0.18
180 0.17
181 0.17
182 0.17
183 0.18
184 0.18
185 0.2
186 0.19
187 0.17
188 0.19
189 0.2
190 0.21
191 0.2
192 0.2
193 0.16
194 0.15
195 0.15
196 0.16
197 0.16
198 0.15
199 0.14
200 0.15
201 0.16
202 0.19
203 0.24
204 0.21
205 0.21
206 0.21
207 0.24
208 0.24
209 0.26
210 0.23
211 0.21
212 0.22
213 0.21
214 0.24
215 0.21
216 0.23
217 0.22
218 0.22
219 0.18
220 0.17
221 0.17
222 0.13
223 0.16
224 0.13
225 0.14
226 0.15
227 0.16
228 0.17
229 0.21
230 0.21
231 0.18
232 0.21
233 0.28
234 0.35
235 0.41
236 0.41
237 0.41
238 0.45
239 0.44
240 0.42
241 0.35
242 0.27
243 0.2
244 0.2
245 0.17
246 0.17
247 0.17
248 0.15
249 0.15
250 0.14
251 0.14
252 0.14
253 0.13
254 0.09
255 0.13
256 0.15
257 0.17
258 0.17
259 0.17
260 0.15
261 0.15
262 0.17
263 0.14
264 0.13
265 0.12
266 0.11
267 0.12
268 0.12
269 0.19
270 0.24
271 0.3
272 0.34
273 0.4
274 0.44
275 0.54
276 0.63
277 0.67
278 0.7
279 0.75
280 0.79
281 0.82
282 0.87
283 0.82
284 0.76
285 0.69
286 0.61
287 0.51
288 0.42
289 0.32
290 0.23
291 0.18
292 0.15
293 0.12
294 0.08
295 0.08
296 0.08
297 0.08
298 0.08
299 0.08
300 0.08
301 0.07
302 0.07
303 0.07
304 0.07
305 0.07
306 0.07
307 0.08
308 0.07
309 0.09
310 0.1
311 0.11
312 0.13
313 0.18
314 0.2
315 0.23
316 0.29
317 0.38
318 0.47
319 0.56
320 0.64
321 0.7
322 0.77
323 0.81
324 0.86
325 0.88
326 0.88
327 0.84
328 0.81
329 0.76
330 0.66
331 0.57
332 0.48
333 0.38
334 0.29
335 0.22
336 0.19
337 0.18
338 0.19
339 0.2
340 0.2
341 0.19
342 0.19
343 0.22
344 0.19