Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WW82

Protein Details
Accession W3WW82   
Localization Confidence High
Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
106-130ETDGKASLKKKTKKNKSANTESQNPHydrophilic
133-156TDTIVPSRKRGRPRKAPGAPKAPYHydrophilic
NLS Segment(s)
PositionSequence
114-120KKKTKKN
139-174SRKRGRPRKAPGAPKAPYNRKVPMAPYNKKTPKPSR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
KEGG pfy:PFICI_11246  -  
Amino Acid Sequences MAIPDKRDNARAYRKFMRTKHYTGCSDEDRHQAVNHAIYSGFTRPQWLVDVRPRYFVTLIEQKTLTPNSPMFKATSASGSATTGTTDTTRPLPDTIAPSPGDVPNETDGKASLKKKTKKNKSANTESQNPENTDTIVPSRKRGRPRKAPGAPKAPYNRKVPMAPYNKKTPKPSRGSTIPAVQQPLPPRSPSSSEEEPQKKRVAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.72
3 0.73
4 0.73
5 0.7
6 0.71
7 0.72
8 0.7
9 0.65
10 0.61
11 0.62
12 0.58
13 0.55
14 0.52
15 0.5
16 0.44
17 0.42
18 0.37
19 0.34
20 0.31
21 0.3
22 0.26
23 0.2
24 0.17
25 0.16
26 0.19
27 0.17
28 0.17
29 0.13
30 0.16
31 0.15
32 0.17
33 0.2
34 0.19
35 0.23
36 0.29
37 0.38
38 0.36
39 0.4
40 0.39
41 0.38
42 0.37
43 0.31
44 0.29
45 0.29
46 0.3
47 0.28
48 0.27
49 0.25
50 0.28
51 0.29
52 0.23
53 0.18
54 0.19
55 0.19
56 0.2
57 0.21
58 0.18
59 0.17
60 0.18
61 0.15
62 0.14
63 0.13
64 0.12
65 0.12
66 0.11
67 0.11
68 0.09
69 0.09
70 0.07
71 0.07
72 0.07
73 0.07
74 0.08
75 0.09
76 0.1
77 0.11
78 0.11
79 0.11
80 0.12
81 0.16
82 0.16
83 0.17
84 0.16
85 0.16
86 0.17
87 0.17
88 0.16
89 0.11
90 0.12
91 0.12
92 0.12
93 0.12
94 0.11
95 0.1
96 0.12
97 0.17
98 0.18
99 0.23
100 0.32
101 0.39
102 0.48
103 0.59
104 0.68
105 0.73
106 0.81
107 0.84
108 0.84
109 0.86
110 0.86
111 0.81
112 0.78
113 0.7
114 0.64
115 0.58
116 0.5
117 0.42
118 0.33
119 0.29
120 0.21
121 0.19
122 0.18
123 0.22
124 0.21
125 0.25
126 0.33
127 0.37
128 0.47
129 0.57
130 0.64
131 0.67
132 0.76
133 0.82
134 0.83
135 0.87
136 0.85
137 0.84
138 0.75
139 0.72
140 0.73
141 0.7
142 0.67
143 0.63
144 0.59
145 0.54
146 0.55
147 0.52
148 0.52
149 0.54
150 0.56
151 0.56
152 0.62
153 0.66
154 0.69
155 0.74
156 0.74
157 0.74
158 0.75
159 0.75
160 0.72
161 0.7
162 0.7
163 0.66
164 0.63
165 0.57
166 0.53
167 0.51
168 0.44
169 0.42
170 0.43
171 0.44
172 0.39
173 0.36
174 0.37
175 0.38
176 0.41
177 0.4
178 0.42
179 0.43
180 0.44
181 0.52
182 0.58
183 0.58
184 0.59