Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WRV6

Protein Details
Accession W3WRV6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MGVEAKSRRRSKRLRNIRRPIHKVNPIQRQSHydrophilic
NLS Segment(s)
PositionSequence
6-23KSRRRSKRLRNIRRPIHK
Subcellular Location(s) mito 12, nucl 7, cyto 6
Family & Domain DBs
KEGG pfy:PFICI_12500  -  
Amino Acid Sequences MGVEAKSRRRSKRLRNIRRPIHKVNPIQRQSLRIAIKRSLEDAESFSHVGRDVIAIRGSPSPIEDLDTTIVDNVIEVQDLSDLSNGIPSGQPGWYKIRRIVGQRLAYYLVEWEGIDPATGQNFPVEFVYQSDVNGPARREWHALQNAGKLRRARCGTLILEDAKESVVYEEAWKRSIRRSCALS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.94
4 0.95
5 0.95
6 0.92
7 0.9
8 0.89
9 0.87
10 0.85
11 0.84
12 0.84
13 0.77
14 0.76
15 0.69
16 0.63
17 0.57
18 0.56
19 0.53
20 0.47
21 0.47
22 0.44
23 0.46
24 0.43
25 0.41
26 0.35
27 0.29
28 0.26
29 0.23
30 0.2
31 0.19
32 0.18
33 0.16
34 0.15
35 0.14
36 0.12
37 0.1
38 0.1
39 0.08
40 0.09
41 0.1
42 0.09
43 0.11
44 0.12
45 0.12
46 0.1
47 0.1
48 0.1
49 0.09
50 0.12
51 0.1
52 0.11
53 0.11
54 0.12
55 0.11
56 0.09
57 0.09
58 0.06
59 0.06
60 0.05
61 0.04
62 0.04
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.09
80 0.15
81 0.18
82 0.19
83 0.22
84 0.26
85 0.29
86 0.33
87 0.38
88 0.39
89 0.41
90 0.39
91 0.38
92 0.35
93 0.31
94 0.26
95 0.2
96 0.12
97 0.08
98 0.08
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.08
112 0.08
113 0.08
114 0.09
115 0.11
116 0.11
117 0.11
118 0.12
119 0.13
120 0.15
121 0.18
122 0.18
123 0.17
124 0.2
125 0.22
126 0.25
127 0.25
128 0.31
129 0.33
130 0.36
131 0.37
132 0.42
133 0.46
134 0.45
135 0.48
136 0.44
137 0.4
138 0.45
139 0.47
140 0.42
141 0.38
142 0.42
143 0.39
144 0.38
145 0.4
146 0.33
147 0.29
148 0.27
149 0.24
150 0.18
151 0.16
152 0.13
153 0.1
154 0.09
155 0.09
156 0.14
157 0.19
158 0.21
159 0.24
160 0.26
161 0.27
162 0.35
163 0.43
164 0.45