Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3XCP1

Protein Details
Accession W3XCP1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
54-74KSLPKLKQLRHKYDPLKRFNQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR016169  FAD-bd_PCMH_sub2  
KEGG pfy:PFICI_05744  -  
Amino Acid Sequences MVIPWYTSKSLDTAGNQFGQDVRGYLNESAGNTQFSAYINFAHGDEALSSISGKSLPKLKQLRHKYDPLKRFNQWFAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.24
4 0.23
5 0.21
6 0.18
7 0.15
8 0.12
9 0.1
10 0.09
11 0.11
12 0.11
13 0.12
14 0.12
15 0.12
16 0.13
17 0.13
18 0.13
19 0.1
20 0.1
21 0.09
22 0.09
23 0.1
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.08
30 0.07
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.07
41 0.08
42 0.16
43 0.17
44 0.27
45 0.35
46 0.41
47 0.5
48 0.6
49 0.68
50 0.68
51 0.76
52 0.76
53 0.79
54 0.82
55 0.8
56 0.78
57 0.75
58 0.75