FuNGI

C4JLU1

Protein Details

Accession

C4JLU1

Localization Confidence

High

Confidence Score

15.4

NoLS Segment(s)

Position	Sequence	Protein Nature
17-46	DGQKDATKSRAPRRRRPNYKHIHRFPLPLT	Hydrophilic

NLS Segment(s)

Position	Sequence
24-34	KSRAPRRRRPN
152-152	K
154-157	ERAR

Subcellular Location(s)

nucl 11.5, mito 9, cyto_nucl 8.5, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR011856 tRNA_endonuc-like_dom_sf IPR036167 tRNA_intron_Endo_cat-like_sf IPR006677 tRNA_intron_Endonuc_cat-like IPR006676 tRNA_splic IPR016589 tRNA_splic_SEN2
Gene Ontology	GO:0000214 C:tRNA-intron endonuclease complex GO:0016829 F:lyase activity GO:0003676 F:nucleic acid binding GO:0000213 F:tRNA-intron endonuclease activity GO:0006388 P:tRNA splicing, via endonucleolytic cleavage and ligation
KEGG	ure:UREG_03799 -
Pfam	View protein in Pfam PF01974 tRNA_int_endo
CDD	cd22363 tRNA-intron_lyase_C

Amino Acid Sequences

MASPAKLSANGSASQADGQKDATKSRAPRRRRPNYKHIHRFPLPLTVHPLPPLIPHNPLSLISIALSYLTYLISPPKHEIYKAYFDAPTSSVHVTDPKTIRALWEMGFFGKGNLSRSEPTWLDREKKRKGLLGVDTSEEATGNRRMERREWKLERARKEKEAVAEQLRAEAAGLHGEGHNAEHNAEQSPSTMTSPDIRAHESIEHRLNAVSGLAPLLVSESVNREDKKPAGHGTKIVRFSSVVDTRKYEKEAILGEPSKLAEVDSSQIIDEEHLQLSNEEAFFLVYGLGVLQVYESNMKSAISTPQLLSLFRRHSYFPPRDEFLPLEPDDRFIVSYVAYHHFRSLGWVVRSGVKFGVDLLLYNRGPVFSHAEFAVVLLPAYEHPYWSETEERRAAVTKKCRHTWWWFHCVNRVQAQVKKTLVLCYVEIPPPAPETEEDGGELDIGALLERYAVREVTIRRWVPNRSRD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.23
2	0.25
3	0.21
4	0.19
5	0.2
6	0.24
7	0.25
8	0.28
9	0.29
10	0.33
11	0.4
12	0.5
13	0.57
14	0.61
15	0.69
16	0.77
17	0.84
18	0.88
19	0.89
20	0.89
21	0.91
22	0.94
23	0.94
24	0.92
25	0.91
26	0.84
27	0.81
28	0.71
29	0.7
30	0.61
31	0.53
32	0.52
33	0.45
34	0.42
35	0.37
36	0.36
37	0.27
38	0.28
39	0.3
40	0.25
41	0.26
42	0.26
43	0.27
44	0.28
45	0.28
46	0.26
47	0.22
48	0.19
49	0.15
50	0.13
51	0.11
52	0.09
53	0.08
54	0.06
55	0.06
56	0.05
57	0.05
58	0.06
59	0.11
60	0.12
61	0.15
62	0.19
63	0.24
64	0.26
65	0.27
66	0.32
67	0.33
68	0.39
69	0.39
70	0.38
71	0.33
72	0.32
73	0.34
74	0.29
75	0.25
76	0.2
77	0.19
78	0.16
79	0.17
80	0.21
81	0.2
82	0.27
83	0.28
84	0.26
85	0.27
86	0.27
87	0.27
88	0.26
89	0.26
90	0.19
91	0.2
92	0.18
93	0.17
94	0.18
95	0.17
96	0.14
97	0.15
98	0.16
99	0.15
100	0.17
101	0.19
102	0.19
103	0.21
104	0.26
105	0.24
106	0.24
107	0.28
108	0.31
109	0.35
110	0.42
111	0.5
112	0.53
113	0.59
114	0.61
115	0.59
116	0.58
117	0.58
118	0.58
119	0.55
120	0.48
121	0.42
122	0.39
123	0.34
124	0.3
125	0.22
126	0.15
127	0.12
128	0.15
129	0.15
130	0.18
131	0.21
132	0.23
133	0.31
134	0.4
135	0.45
136	0.52
137	0.55
138	0.61
139	0.68
140	0.73
141	0.75
142	0.74
143	0.72
144	0.65
145	0.64
146	0.58
147	0.53
148	0.5
149	0.46
150	0.4
151	0.38
152	0.33
153	0.3
154	0.26
155	0.21
156	0.16
157	0.11
158	0.08
159	0.05
160	0.06
161	0.05
162	0.05
163	0.06
164	0.06
165	0.06
166	0.08
167	0.07
168	0.08
169	0.08
170	0.09
171	0.1
172	0.1
173	0.09
174	0.08
175	0.09
176	0.1
177	0.1
178	0.09
179	0.09
180	0.11
181	0.13
182	0.16
183	0.16
184	0.17
185	0.17
186	0.17
187	0.21
188	0.21
189	0.23
190	0.23
191	0.22
192	0.2
193	0.2
194	0.19
195	0.15
196	0.13
197	0.08
198	0.05
199	0.05
200	0.04
201	0.04
202	0.04
203	0.04
204	0.04
205	0.04
206	0.04
207	0.06
208	0.08
209	0.12
210	0.13
211	0.14
212	0.16
213	0.18
214	0.2
215	0.2
216	0.24
217	0.24
218	0.24
219	0.28
220	0.31
221	0.35
222	0.36
223	0.34
224	0.29
225	0.25
226	0.26
227	0.27
228	0.29
229	0.26
230	0.24
231	0.26
232	0.29
233	0.31
234	0.31
235	0.25
236	0.19
237	0.2
238	0.2
239	0.19
240	0.21
241	0.2
242	0.18
243	0.17
244	0.16
245	0.14
246	0.12
247	0.1
248	0.05
249	0.05
250	0.07
251	0.06
252	0.06
253	0.06
254	0.06
255	0.06
256	0.06
257	0.07
258	0.07
259	0.07
260	0.07
261	0.07
262	0.07
263	0.08
264	0.09
265	0.07
266	0.06
267	0.06
268	0.06
269	0.05
270	0.06
271	0.05
272	0.03
273	0.03
274	0.03
275	0.03
276	0.03
277	0.03
278	0.03
279	0.03
280	0.04
281	0.06
282	0.06
283	0.07
284	0.07
285	0.07
286	0.08
287	0.09
288	0.12
289	0.12
290	0.13
291	0.13
292	0.17
293	0.18
294	0.19
295	0.2
296	0.23
297	0.24
298	0.24
299	0.26
300	0.24
301	0.29
302	0.39
303	0.43
304	0.42
305	0.43
306	0.45
307	0.44
308	0.45
309	0.4
310	0.32
311	0.32
312	0.27
313	0.24
314	0.22
315	0.22
316	0.19
317	0.18
318	0.16
319	0.11
320	0.11
321	0.08
322	0.09
323	0.11
324	0.15
325	0.17
326	0.17
327	0.17
328	0.17
329	0.17
330	0.21
331	0.21
332	0.23
333	0.22
334	0.24
335	0.25
336	0.31
337	0.31
338	0.28
339	0.25
340	0.19
341	0.18
342	0.16
343	0.17
344	0.1
345	0.11
346	0.11
347	0.17
348	0.16
349	0.17
350	0.17
351	0.14
352	0.15
353	0.17
354	0.21
355	0.15
356	0.17
357	0.17
358	0.17
359	0.17
360	0.16
361	0.15
362	0.08
363	0.08
364	0.06
365	0.06
366	0.06
367	0.11
368	0.11
369	0.1
370	0.11
371	0.13
372	0.14
373	0.17
374	0.25
375	0.22
376	0.29
377	0.32
378	0.31
379	0.32
380	0.36
381	0.37
382	0.38
383	0.47
384	0.49
385	0.55
386	0.6
387	0.62
388	0.64
389	0.7
390	0.72
391	0.7
392	0.71
393	0.67
394	0.65
395	0.69
396	0.68
397	0.64
398	0.6
399	0.58
400	0.55
401	0.55
402	0.55
403	0.53
404	0.49
405	0.46
406	0.41
407	0.37
408	0.35
409	0.32
410	0.3
411	0.26
412	0.29
413	0.28
414	0.28
415	0.25
416	0.23
417	0.22
418	0.22
419	0.2
420	0.17
421	0.21
422	0.22
423	0.21
424	0.2
425	0.19
426	0.18
427	0.16
428	0.15
429	0.08
430	0.07
431	0.06
432	0.06
433	0.05
434	0.04
435	0.06
436	0.06
437	0.09
438	0.1
439	0.1
440	0.11
441	0.17
442	0.21
443	0.27
444	0.37
445	0.37
446	0.42
447	0.48
448	0.57

C4JLU1

3D AlphaFold-predicted Structure Viewer