Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3XAT5

Protein Details
Accession W3XAT5   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRRPGRRRSRRSRRGFRADLVRABasic
NLS Segment(s)
PositionSequence
2-36RRPGRRRSRRSRRGFRADLVRAIEMRHERRRAQGR
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
KEGG pfy:PFICI_05025  -  
Amino Acid Sequences MRRPGRRRSRRSRRGFRADLVRAIEMRHERRRAQGRMGFRREFRQALEMSLERERAMGRQSLLEQYIEALEMREERRRWHGVVISPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.88
3 0.83
4 0.82
5 0.75
6 0.68
7 0.6
8 0.51
9 0.41
10 0.36
11 0.34
12 0.31
13 0.34
14 0.37
15 0.38
16 0.38
17 0.47
18 0.55
19 0.53
20 0.55
21 0.53
22 0.55
23 0.6
24 0.65
25 0.59
26 0.52
27 0.53
28 0.48
29 0.44
30 0.35
31 0.3
32 0.23
33 0.21
34 0.23
35 0.19
36 0.18
37 0.18
38 0.17
39 0.13
40 0.13
41 0.13
42 0.11
43 0.12
44 0.12
45 0.11
46 0.13
47 0.14
48 0.16
49 0.17
50 0.16
51 0.14
52 0.12
53 0.12
54 0.1
55 0.09
56 0.07
57 0.07
58 0.1
59 0.13
60 0.2
61 0.21
62 0.24
63 0.32
64 0.36
65 0.37
66 0.41
67 0.44