Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3XI55

Protein Details
Accession W3XI55   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
76-112DKPSSNTRNSKNRIAKRKKPSKIVFPKYSDRKKTKKRBasic
NLS Segment(s)
PositionSequence
85-112SKNRIAKRKKPSKIVFPKYSDRKKTKKR
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG pfy:PFICI_03753  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRASTVKTNNQRLKAKVFGPVEQARMERLSAKLLEVAAAPKPEKPEAENEMKIVDDEAEAKADQDDATMDVDKPSSNTRNSKNRIAKRKKPSKIVFPKYSDRKKTKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.73
4 0.69
5 0.64
6 0.56
7 0.54
8 0.49
9 0.42
10 0.43
11 0.42
12 0.38
13 0.35
14 0.33
15 0.27
16 0.25
17 0.23
18 0.18
19 0.16
20 0.17
21 0.15
22 0.15
23 0.14
24 0.13
25 0.13
26 0.11
27 0.11
28 0.1
29 0.11
30 0.11
31 0.12
32 0.14
33 0.15
34 0.15
35 0.15
36 0.19
37 0.22
38 0.28
39 0.27
40 0.24
41 0.23
42 0.22
43 0.21
44 0.16
45 0.11
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.09
65 0.14
66 0.17
67 0.22
68 0.28
69 0.36
70 0.46
71 0.52
72 0.61
73 0.66
74 0.71
75 0.77
76 0.81
77 0.82
78 0.83
79 0.89
80 0.87
81 0.88
82 0.86
83 0.86
84 0.87
85 0.87
86 0.85
87 0.81
88 0.83
89 0.83
90 0.85
91 0.84
92 0.83