Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WUB6

Protein Details
Accession W3WUB6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKSSSKPQGPKKRAPLATTHydrophilic
NLS Segment(s)
PositionSequence
3-16KRKSSSKPQGPKKR
Subcellular Location(s) mito 18.5, cyto_mito 11, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
KEGG pfy:PFICI_12104  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSKPQGPKKRAPLATTFTCLFCNHEKSVSVKVDKKAGVGSLSCSVCAQSFQCGANYLSAPIDIYSEWVDAADAVAKEEAGNPTRTQASNSRSKQAADRYDDDEDDRRYEGEGIVDDDDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.82
4 0.75
5 0.71
6 0.67
7 0.62
8 0.57
9 0.48
10 0.39
11 0.36
12 0.32
13 0.29
14 0.27
15 0.28
16 0.25
17 0.26
18 0.26
19 0.27
20 0.34
21 0.36
22 0.36
23 0.37
24 0.37
25 0.41
26 0.39
27 0.37
28 0.31
29 0.27
30 0.22
31 0.17
32 0.17
33 0.17
34 0.17
35 0.16
36 0.15
37 0.14
38 0.13
39 0.14
40 0.11
41 0.08
42 0.1
43 0.1
44 0.11
45 0.12
46 0.13
47 0.13
48 0.12
49 0.1
50 0.09
51 0.08
52 0.08
53 0.06
54 0.06
55 0.04
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.05
64 0.06
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.08
71 0.11
72 0.11
73 0.13
74 0.12
75 0.15
76 0.18
77 0.18
78 0.2
79 0.24
80 0.28
81 0.36
82 0.39
83 0.42
84 0.41
85 0.42
86 0.45
87 0.46
88 0.48
89 0.44
90 0.45
91 0.45
92 0.46
93 0.45
94 0.43
95 0.4
96 0.35
97 0.31
98 0.28
99 0.23
100 0.22
101 0.22
102 0.19
103 0.16
104 0.15
105 0.16
106 0.15