Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JUW8

Protein Details
Accession C4JUW8   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
97-125HKTKIIPWARSRRRMKKARSLPKRKSIRABasic
222-250VFVMSRGKLCRHQRRRKQPEQPPEPETRTHydrophilic
NLS Segment(s)
PositionSequence
102-125IPWARSRRRMKKARSLPKRKSIRA
Subcellular Location(s) nucl 13, mito 8, cyto_nucl 8
Family & Domain DBs
KEGG ure:UREG_04921  -  
Amino Acid Sequences MNPIHIPWGQDGGTGLSLCDANSSIGGMPFTTLYIIERQADLEVLHAIVDNPKLMAKEKICGFLFLNHNFSMRGCKRARILVDTYKFDIPIELSLAHKTKIIPWARSRRRMKKARSLPKRKSIRAEKLQNWEHSNEHTARTPLPNVDNSNRLRIRGGCLGLFKKKKPLDDEEVVPALVWWFAGGRSANDGSRPTGQQLREWKRRSKGDWGEGHQRGFFKECVFVMSRGKLCRHQRRRKQPEQPPEPETRTGAGTGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.11
4 0.12
5 0.11
6 0.11
7 0.09
8 0.08
9 0.08
10 0.09
11 0.09
12 0.1
13 0.1
14 0.09
15 0.09
16 0.08
17 0.09
18 0.08
19 0.07
20 0.08
21 0.1
22 0.12
23 0.13
24 0.13
25 0.13
26 0.13
27 0.14
28 0.12
29 0.1
30 0.09
31 0.08
32 0.08
33 0.07
34 0.07
35 0.09
36 0.09
37 0.08
38 0.08
39 0.1
40 0.11
41 0.13
42 0.19
43 0.18
44 0.23
45 0.25
46 0.31
47 0.3
48 0.32
49 0.31
50 0.31
51 0.36
52 0.33
53 0.34
54 0.28
55 0.28
56 0.26
57 0.25
58 0.29
59 0.24
60 0.3
61 0.28
62 0.31
63 0.33
64 0.38
65 0.4
66 0.36
67 0.4
68 0.4
69 0.44
70 0.43
71 0.43
72 0.38
73 0.35
74 0.3
75 0.25
76 0.17
77 0.13
78 0.11
79 0.09
80 0.09
81 0.12
82 0.13
83 0.13
84 0.13
85 0.13
86 0.14
87 0.22
88 0.25
89 0.27
90 0.35
91 0.46
92 0.52
93 0.62
94 0.69
95 0.71
96 0.77
97 0.81
98 0.8
99 0.8
100 0.83
101 0.84
102 0.85
103 0.86
104 0.83
105 0.84
106 0.85
107 0.78
108 0.77
109 0.76
110 0.74
111 0.73
112 0.74
113 0.69
114 0.69
115 0.7
116 0.64
117 0.56
118 0.48
119 0.4
120 0.33
121 0.31
122 0.24
123 0.21
124 0.19
125 0.18
126 0.17
127 0.18
128 0.18
129 0.16
130 0.17
131 0.18
132 0.21
133 0.22
134 0.27
135 0.27
136 0.34
137 0.33
138 0.31
139 0.3
140 0.27
141 0.29
142 0.27
143 0.27
144 0.2
145 0.23
146 0.26
147 0.33
148 0.36
149 0.33
150 0.38
151 0.4
152 0.43
153 0.44
154 0.48
155 0.47
156 0.47
157 0.48
158 0.43
159 0.4
160 0.36
161 0.3
162 0.23
163 0.15
164 0.11
165 0.08
166 0.04
167 0.03
168 0.03
169 0.07
170 0.07
171 0.08
172 0.12
173 0.14
174 0.14
175 0.16
176 0.17
177 0.17
178 0.2
179 0.21
180 0.21
181 0.25
182 0.26
183 0.3
184 0.39
185 0.46
186 0.53
187 0.57
188 0.62
189 0.65
190 0.72
191 0.7
192 0.7
193 0.7
194 0.69
195 0.71
196 0.7
197 0.71
198 0.67
199 0.64
200 0.56
201 0.48
202 0.41
203 0.37
204 0.32
205 0.23
206 0.23
207 0.21
208 0.23
209 0.25
210 0.26
211 0.27
212 0.32
213 0.35
214 0.36
215 0.4
216 0.45
217 0.53
218 0.61
219 0.67
220 0.72
221 0.79
222 0.86
223 0.93
224 0.95
225 0.95
226 0.94
227 0.94
228 0.93
229 0.89
230 0.84
231 0.82
232 0.76
233 0.69
234 0.61
235 0.51
236 0.43