Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WU17

Protein Details
Accession W3WU17    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-33AESSPKKGSKGSRRHPKKSKARNPSSTAVHydrophilic
NLS Segment(s)
PositionSequence
9-26PKKGSKGSRRHPKKSKAR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
KEGG pfy:PFICI_11718  -  
Amino Acid Sequences MPNQAESSPKKGSKGSRRHPKKSKARNPSSTAVEHSSTSERLANEDNSDVTEPASGYNTFHDETETRSDQDYFLLYMGSQFDGDEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.7
4 0.78
5 0.85
6 0.9
7 0.9
8 0.91
9 0.92
10 0.91
11 0.91
12 0.91
13 0.88
14 0.84
15 0.79
16 0.72
17 0.62
18 0.55
19 0.47
20 0.38
21 0.3
22 0.26
23 0.22
24 0.18
25 0.17
26 0.16
27 0.13
28 0.14
29 0.15
30 0.14
31 0.13
32 0.13
33 0.12
34 0.11
35 0.12
36 0.1
37 0.08
38 0.08
39 0.07
40 0.07
41 0.09
42 0.08
43 0.08
44 0.09
45 0.12
46 0.12
47 0.12
48 0.14
49 0.12
50 0.15
51 0.22
52 0.22
53 0.21
54 0.22
55 0.23
56 0.21
57 0.22
58 0.2
59 0.14
60 0.12
61 0.11
62 0.09
63 0.1
64 0.11
65 0.1
66 0.09