Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W3WKB7

Protein Details
Accession W3WKB7    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
110-135SRGGGTPSPKLRKQKKIKSAMDLPELHydrophilic
NLS Segment(s)
PositionSequence
118-125PKLRKQKK
Subcellular Location(s) cysk 16, nucl 8, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001950  SUI1  
IPR036877  SUI1_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0003743  F:translation initiation factor activity  
KEGG pfy:PFICI_14164  -  
Pfam View protein in Pfam  
PF01253  SUI1  
PROSITE View protein in PROSITE  
PS50296  SUI1  
Amino Acid Sequences MASNESESRVISGIPFDPFTPPTIQIKVHKLRFTLVEGLDSNPYIDLKAVFKQMKKSLGCGGMIMNDPEVGESIVLSGDQRSKVERFLVDEEQGLGISHRFVKVVEAEASRGGGTPSPKLRKQKKIKSAMDLPELMRLNNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.17
5 0.17
6 0.2
7 0.2
8 0.21
9 0.23
10 0.25
11 0.28
12 0.31
13 0.4
14 0.46
15 0.49
16 0.49
17 0.46
18 0.45
19 0.44
20 0.42
21 0.38
22 0.29
23 0.26
24 0.24
25 0.24
26 0.23
27 0.2
28 0.16
29 0.12
30 0.11
31 0.08
32 0.08
33 0.07
34 0.08
35 0.1
36 0.17
37 0.19
38 0.21
39 0.27
40 0.31
41 0.37
42 0.36
43 0.36
44 0.34
45 0.33
46 0.31
47 0.25
48 0.21
49 0.16
50 0.16
51 0.14
52 0.09
53 0.07
54 0.07
55 0.06
56 0.06
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.06
66 0.07
67 0.07
68 0.1
69 0.11
70 0.12
71 0.15
72 0.14
73 0.16
74 0.2
75 0.22
76 0.2
77 0.2
78 0.19
79 0.16
80 0.16
81 0.12
82 0.08
83 0.06
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.09
90 0.11
91 0.14
92 0.16
93 0.16
94 0.17
95 0.17
96 0.17
97 0.15
98 0.14
99 0.11
100 0.11
101 0.12
102 0.17
103 0.26
104 0.33
105 0.39
106 0.5
107 0.59
108 0.67
109 0.76
110 0.81
111 0.82
112 0.86
113 0.86
114 0.85
115 0.84
116 0.8
117 0.75
118 0.67
119 0.57
120 0.54
121 0.48