Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CR22

Protein Details
Accession Q6CR22   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
80-114RMDSVMRKRRTKMKKHKLRKRRKRQKAEKRKQSQGBasic
NLS Segment(s)
PositionSequence
86-112RKRRTKMKKHKLRKRRKRQKAEKRKQS
Subcellular Location(s) mito 18.5, mito_nucl 13.166, nucl 6.5, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
KEGG kla:KLLA0_D12452g  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLRSITTRLTSPISGSLRCLSVACCNTQMAVPMGMPMGMPIGMTAGIPTGSLGLPVQENNHMTEPIVSITDLIKKQEEYRMDSVMRKRRTKMKKHKLRKRRKRQKAEKRKQSQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.28
4 0.25
5 0.25
6 0.23
7 0.17
8 0.21
9 0.23
10 0.22
11 0.21
12 0.21
13 0.2
14 0.2
15 0.21
16 0.14
17 0.13
18 0.11
19 0.1
20 0.09
21 0.09
22 0.08
23 0.06
24 0.05
25 0.04
26 0.04
27 0.03
28 0.04
29 0.04
30 0.04
31 0.04
32 0.03
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.06
44 0.07
45 0.08
46 0.1
47 0.11
48 0.1
49 0.1
50 0.1
51 0.1
52 0.09
53 0.08
54 0.06
55 0.06
56 0.07
57 0.11
58 0.12
59 0.12
60 0.13
61 0.14
62 0.16
63 0.21
64 0.23
65 0.25
66 0.27
67 0.29
68 0.3
69 0.35
70 0.41
71 0.45
72 0.5
73 0.49
74 0.52
75 0.59
76 0.67
77 0.73
78 0.76
79 0.78
80 0.81
81 0.88
82 0.94
83 0.95
84 0.96
85 0.96
86 0.96
87 0.96
88 0.96
89 0.96
90 0.97
91 0.97
92 0.97
93 0.97
94 0.97