Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WHG2

Protein Details
Accession W3WHG2    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-30TSADSRSKRAVKKRALTPVSHydrophilic
119-149ELARKDDEKTRRNREKREKMKARKAKAKAGGBasic
NLS Segment(s)
PositionSequence
116-154KREELARKDDEKTRRNREKREKMKARKAKAKAGGGAAKA
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
KEGG pfy:PFICI_14965  -  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSGEGPESIPTSADSRSKRAVKKRALTPVSAQASNVDALFARPDQDIRIPDSSTAVARSRIAPPPEIVTNVQGSSAGAGSGEFHVYKASRRREYERLRQMDVEVKQEQENEEFERKREELARKDDEKTRRNREKREKMKARKAKAKAGGGAAKASTNGTKGPRIAVTRADDGEEDTEIKDAPVAAEEPKGLVIEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.37
4 0.44
5 0.51
6 0.6
7 0.66
8 0.69
9 0.75
10 0.78
11 0.8
12 0.76
13 0.7
14 0.65
15 0.65
16 0.59
17 0.5
18 0.42
19 0.32
20 0.3
21 0.27
22 0.22
23 0.13
24 0.08
25 0.08
26 0.1
27 0.09
28 0.09
29 0.09
30 0.1
31 0.12
32 0.16
33 0.18
34 0.2
35 0.22
36 0.21
37 0.21
38 0.22
39 0.21
40 0.17
41 0.18
42 0.16
43 0.14
44 0.15
45 0.17
46 0.19
47 0.24
48 0.25
49 0.24
50 0.23
51 0.25
52 0.25
53 0.25
54 0.22
55 0.18
56 0.18
57 0.16
58 0.15
59 0.11
60 0.1
61 0.08
62 0.07
63 0.05
64 0.04
65 0.04
66 0.04
67 0.05
68 0.06
69 0.05
70 0.05
71 0.07
72 0.07
73 0.12
74 0.19
75 0.26
76 0.31
77 0.34
78 0.4
79 0.49
80 0.57
81 0.62
82 0.64
83 0.61
84 0.57
85 0.53
86 0.49
87 0.45
88 0.39
89 0.33
90 0.24
91 0.21
92 0.2
93 0.2
94 0.2
95 0.15
96 0.15
97 0.14
98 0.19
99 0.19
100 0.19
101 0.22
102 0.22
103 0.22
104 0.28
105 0.31
106 0.32
107 0.39
108 0.46
109 0.45
110 0.48
111 0.53
112 0.55
113 0.56
114 0.58
115 0.62
116 0.65
117 0.7
118 0.78
119 0.82
120 0.85
121 0.88
122 0.9
123 0.9
124 0.9
125 0.93
126 0.91
127 0.89
128 0.88
129 0.83
130 0.81
131 0.78
132 0.72
133 0.64
134 0.61
135 0.56
136 0.47
137 0.43
138 0.34
139 0.26
140 0.22
141 0.2
142 0.15
143 0.11
144 0.14
145 0.16
146 0.19
147 0.2
148 0.22
149 0.25
150 0.28
151 0.29
152 0.31
153 0.33
154 0.33
155 0.33
156 0.32
157 0.27
158 0.26
159 0.25
160 0.2
161 0.16
162 0.12
163 0.12
164 0.11
165 0.11
166 0.1
167 0.08
168 0.07
169 0.09
170 0.09
171 0.1
172 0.12
173 0.12
174 0.12
175 0.13
176 0.13