Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3X1A4

Protein Details
Accession W3X1A4    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
266-286LKPLCEQAQKGRPKRKAPETNHydrophilic
NLS Segment(s)
PositionSequence
277-281RPKRK
Subcellular Location(s) nucl 10.5, cyto_nucl 8.5, cyto 5.5, plas 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
KEGG pfy:PFICI_08799  -  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
Amino Acid Sequences MPAETRGSVRQRKAAAVRAEQEPTPRVVELNTSDDEEEFIKNGTGPLQQEPRPKPTPKARVKADDDEYSPWLDVLRVLTFLVLAGVGLSYLISNGTTFGLDKLAKHPPKYFRKDWWTEQFKTPLQLTPAELSAYDGSDPEKPIYLAINGTIYDVSANRRTYGPGGSYHVFAGVDAARGFVTGCFADDRTADLRGIEEMHIPRDDPEVDSLYTAADLEALKVRERAEAEQKVRDQLSHWVNFFARSPKYPHVGTVKREPGWLDKEPLKPLCEQAQKGRPKRKAPETN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.56
4 0.56
5 0.53
6 0.54
7 0.47
8 0.46
9 0.39
10 0.35
11 0.3
12 0.26
13 0.22
14 0.19
15 0.23
16 0.22
17 0.24
18 0.23
19 0.22
20 0.22
21 0.22
22 0.22
23 0.19
24 0.16
25 0.12
26 0.11
27 0.1
28 0.1
29 0.1
30 0.11
31 0.13
32 0.14
33 0.2
34 0.26
35 0.3
36 0.39
37 0.44
38 0.5
39 0.54
40 0.55
41 0.58
42 0.62
43 0.68
44 0.69
45 0.74
46 0.73
47 0.74
48 0.77
49 0.76
50 0.71
51 0.64
52 0.56
53 0.5
54 0.44
55 0.36
56 0.29
57 0.22
58 0.16
59 0.12
60 0.11
61 0.1
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.08
68 0.07
69 0.04
70 0.03
71 0.03
72 0.03
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.03
81 0.04
82 0.04
83 0.05
84 0.05
85 0.06
86 0.09
87 0.09
88 0.1
89 0.13
90 0.23
91 0.26
92 0.28
93 0.34
94 0.4
95 0.5
96 0.57
97 0.58
98 0.57
99 0.63
100 0.66
101 0.68
102 0.69
103 0.66
104 0.61
105 0.61
106 0.58
107 0.49
108 0.46
109 0.4
110 0.31
111 0.26
112 0.24
113 0.21
114 0.16
115 0.16
116 0.13
117 0.12
118 0.11
119 0.1
120 0.09
121 0.07
122 0.06
123 0.07
124 0.08
125 0.09
126 0.08
127 0.08
128 0.08
129 0.08
130 0.09
131 0.08
132 0.07
133 0.06
134 0.07
135 0.06
136 0.07
137 0.06
138 0.05
139 0.05
140 0.06
141 0.08
142 0.12
143 0.12
144 0.13
145 0.14
146 0.15
147 0.16
148 0.17
149 0.16
150 0.13
151 0.17
152 0.17
153 0.17
154 0.16
155 0.16
156 0.13
157 0.12
158 0.11
159 0.07
160 0.08
161 0.07
162 0.07
163 0.06
164 0.07
165 0.07
166 0.05
167 0.06
168 0.05
169 0.06
170 0.07
171 0.07
172 0.08
173 0.08
174 0.11
175 0.11
176 0.12
177 0.11
178 0.11
179 0.11
180 0.1
181 0.12
182 0.09
183 0.12
184 0.12
185 0.14
186 0.14
187 0.14
188 0.14
189 0.16
190 0.16
191 0.13
192 0.15
193 0.15
194 0.15
195 0.15
196 0.14
197 0.11
198 0.1
199 0.09
200 0.07
201 0.05
202 0.05
203 0.06
204 0.1
205 0.11
206 0.12
207 0.14
208 0.15
209 0.17
210 0.19
211 0.23
212 0.28
213 0.36
214 0.38
215 0.43
216 0.45
217 0.46
218 0.44
219 0.4
220 0.33
221 0.33
222 0.37
223 0.35
224 0.34
225 0.33
226 0.33
227 0.34
228 0.35
229 0.33
230 0.29
231 0.27
232 0.33
233 0.35
234 0.4
235 0.39
236 0.42
237 0.45
238 0.49
239 0.51
240 0.55
241 0.57
242 0.53
243 0.54
244 0.51
245 0.48
246 0.48
247 0.46
248 0.42
249 0.42
250 0.46
251 0.51
252 0.53
253 0.48
254 0.43
255 0.44
256 0.48
257 0.49
258 0.48
259 0.51
260 0.56
261 0.64
262 0.72
263 0.78
264 0.77
265 0.79
266 0.84