Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JK82

Protein Details
Accession C4JK82    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
69-92LTNPAVQIRTRKRRHHNSEMNIGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
KEGG ure:UREG_02039  -  
Amino Acid Sequences MHKIPSFFRLAKPADGRREAAWDLVENGPNTRAPCSVMENYETEIYMQPTSQQGGSWKMITPEGFLYPLTNPAVQIRTRKRRHHNSEMNIGSPRDAVEDILPVLSGSMFPQPGGDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.53
4 0.46
5 0.48
6 0.42
7 0.35
8 0.29
9 0.21
10 0.21
11 0.21
12 0.23
13 0.18
14 0.18
15 0.18
16 0.19
17 0.19
18 0.17
19 0.15
20 0.14
21 0.16
22 0.2
23 0.21
24 0.21
25 0.21
26 0.21
27 0.22
28 0.2
29 0.18
30 0.13
31 0.12
32 0.12
33 0.1
34 0.09
35 0.09
36 0.09
37 0.1
38 0.09
39 0.09
40 0.09
41 0.13
42 0.14
43 0.14
44 0.13
45 0.13
46 0.14
47 0.14
48 0.13
49 0.1
50 0.1
51 0.1
52 0.09
53 0.09
54 0.08
55 0.11
56 0.11
57 0.1
58 0.1
59 0.11
60 0.14
61 0.16
62 0.24
63 0.32
64 0.41
65 0.49
66 0.59
67 0.67
68 0.76
69 0.83
70 0.85
71 0.85
72 0.81
73 0.83
74 0.76
75 0.68
76 0.6
77 0.51
78 0.4
79 0.3
80 0.24
81 0.16
82 0.14
83 0.12
84 0.1
85 0.11
86 0.11
87 0.1
88 0.1
89 0.08
90 0.08
91 0.07
92 0.06
93 0.06
94 0.1
95 0.1
96 0.1