Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W3WPC7

Protein Details
Accession W3WPC7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-23FTSLARRHSRCLRPSSCRGKLNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
KEGG pfy:PFICI_12674  -  
Amino Acid Sequences MFTSLARRHSRCLRPSSCRGKLNIWESASVHQYTSISPFSTTRRCDAGPRIKAGGSFAKVRFSQTDVPQLAFWKERARPPLVSGLDPEDCFRSAHTYVDLAIADRPGWRNTLRDPPHSLSYETLHYMAAMVIAGSPGPAFPIALHIYTTLVSLNYTPSILTMTRLALMRNLLGQPQFRETEEKFAALVRRKDDPNACTLQGMILMAKSTPETDKKALEWFRLAASLGGEEPGAWEWQGACAVEMGKVYLRLKNPQRAKDIFKYSAETLDAPEAALLYSSLLDDSDPEKYIWTRKAAVSAVNNAAREMARLEGLRAPSQDSKSVGAWEKKKSLVLQREWEAIAGDRAIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.8
3 0.83
4 0.82
5 0.78
6 0.74
7 0.71
8 0.71
9 0.67
10 0.64
11 0.55
12 0.5
13 0.45
14 0.45
15 0.41
16 0.33
17 0.28
18 0.22
19 0.21
20 0.19
21 0.22
22 0.2
23 0.17
24 0.17
25 0.2
26 0.25
27 0.32
28 0.34
29 0.33
30 0.36
31 0.36
32 0.41
33 0.49
34 0.53
35 0.51
36 0.52
37 0.52
38 0.48
39 0.47
40 0.45
41 0.41
42 0.33
43 0.34
44 0.31
45 0.33
46 0.33
47 0.35
48 0.33
49 0.31
50 0.35
51 0.32
52 0.41
53 0.36
54 0.37
55 0.35
56 0.35
57 0.33
58 0.28
59 0.26
60 0.24
61 0.28
62 0.32
63 0.37
64 0.39
65 0.38
66 0.39
67 0.46
68 0.41
69 0.37
70 0.33
71 0.32
72 0.3
73 0.29
74 0.27
75 0.2
76 0.18
77 0.17
78 0.16
79 0.17
80 0.16
81 0.17
82 0.17
83 0.15
84 0.15
85 0.17
86 0.16
87 0.11
88 0.11
89 0.1
90 0.09
91 0.11
92 0.13
93 0.12
94 0.15
95 0.15
96 0.17
97 0.21
98 0.31
99 0.33
100 0.35
101 0.41
102 0.42
103 0.46
104 0.45
105 0.42
106 0.33
107 0.31
108 0.28
109 0.23
110 0.2
111 0.14
112 0.12
113 0.12
114 0.09
115 0.07
116 0.05
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.02
124 0.03
125 0.03
126 0.03
127 0.03
128 0.07
129 0.08
130 0.09
131 0.09
132 0.09
133 0.09
134 0.1
135 0.1
136 0.06
137 0.05
138 0.05
139 0.05
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.07
146 0.07
147 0.07
148 0.07
149 0.07
150 0.09
151 0.1
152 0.1
153 0.09
154 0.09
155 0.09
156 0.09
157 0.09
158 0.09
159 0.1
160 0.11
161 0.11
162 0.13
163 0.14
164 0.13
165 0.18
166 0.17
167 0.22
168 0.21
169 0.2
170 0.18
171 0.19
172 0.23
173 0.24
174 0.26
175 0.22
176 0.26
177 0.26
178 0.31
179 0.34
180 0.3
181 0.29
182 0.29
183 0.28
184 0.23
185 0.22
186 0.18
187 0.14
188 0.12
189 0.08
190 0.05
191 0.05
192 0.04
193 0.05
194 0.05
195 0.05
196 0.08
197 0.11
198 0.15
199 0.17
200 0.18
201 0.19
202 0.27
203 0.28
204 0.27
205 0.26
206 0.23
207 0.21
208 0.2
209 0.2
210 0.13
211 0.1
212 0.09
213 0.07
214 0.07
215 0.06
216 0.05
217 0.06
218 0.06
219 0.06
220 0.05
221 0.05
222 0.05
223 0.06
224 0.07
225 0.06
226 0.06
227 0.06
228 0.07
229 0.07
230 0.07
231 0.07
232 0.07
233 0.11
234 0.12
235 0.16
236 0.18
237 0.26
238 0.34
239 0.42
240 0.49
241 0.52
242 0.59
243 0.6
244 0.65
245 0.64
246 0.65
247 0.6
248 0.54
249 0.52
250 0.45
251 0.42
252 0.36
253 0.28
254 0.22
255 0.19
256 0.18
257 0.13
258 0.12
259 0.09
260 0.08
261 0.07
262 0.06
263 0.04
264 0.04
265 0.04
266 0.05
267 0.04
268 0.04
269 0.06
270 0.08
271 0.1
272 0.11
273 0.11
274 0.13
275 0.16
276 0.22
277 0.25
278 0.28
279 0.29
280 0.29
281 0.34
282 0.34
283 0.37
284 0.35
285 0.36
286 0.39
287 0.38
288 0.37
289 0.32
290 0.32
291 0.26
292 0.23
293 0.19
294 0.13
295 0.13
296 0.13
297 0.15
298 0.18
299 0.21
300 0.24
301 0.23
302 0.27
303 0.31
304 0.33
305 0.35
306 0.33
307 0.33
308 0.31
309 0.36
310 0.39
311 0.41
312 0.44
313 0.47
314 0.5
315 0.5
316 0.53
317 0.53
318 0.56
319 0.57
320 0.59
321 0.6
322 0.6
323 0.61
324 0.57
325 0.51
326 0.42
327 0.34
328 0.28