Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JWD6

Protein Details
Accession C4JWD6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPATKKPASKPAKEKNPPKKPTKWTEEERHydrophilic
NLS Segment(s)
PositionSequence
5-22KKPASKPAKEKNPPKKPT
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
KEGG ure:UREG_06878  -  
Amino Acid Sequences MPATKKPASKPAKEKNPPKKPTKWTEEERIFLAAMRLATNWSWEEIRGEHEKAFEGRGRTAKDLESQYNKALKPKLDRAKGDRTFADALDDYRHYGKATHPDDQRVIDQALEFLERLDKKDRLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.91
4 0.9
5 0.88
6 0.87
7 0.85
8 0.85
9 0.83
10 0.81
11 0.77
12 0.79
13 0.76
14 0.68
15 0.6
16 0.51
17 0.42
18 0.34
19 0.27
20 0.18
21 0.13
22 0.11
23 0.09
24 0.09
25 0.09
26 0.11
27 0.11
28 0.11
29 0.1
30 0.1
31 0.12
32 0.11
33 0.15
34 0.17
35 0.18
36 0.17
37 0.17
38 0.18
39 0.17
40 0.18
41 0.16
42 0.15
43 0.16
44 0.19
45 0.21
46 0.21
47 0.22
48 0.2
49 0.22
50 0.23
51 0.25
52 0.25
53 0.25
54 0.27
55 0.3
56 0.3
57 0.3
58 0.3
59 0.3
60 0.32
61 0.4
62 0.45
63 0.48
64 0.51
65 0.53
66 0.61
67 0.6
68 0.58
69 0.48
70 0.44
71 0.39
72 0.34
73 0.32
74 0.21
75 0.19
76 0.19
77 0.19
78 0.16
79 0.16
80 0.17
81 0.14
82 0.15
83 0.18
84 0.25
85 0.28
86 0.34
87 0.36
88 0.4
89 0.42
90 0.44
91 0.42
92 0.35
93 0.32
94 0.25
95 0.22
96 0.18
97 0.16
98 0.14
99 0.13
100 0.1
101 0.16
102 0.16
103 0.2
104 0.26