Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4K0A7

Protein Details
Accession C4K0A7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-33QRPIGDSQRKPNRRQRGKPTEPTIHAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 10, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
KEGG ure:UREG_07921  -  
Amino Acid Sequences MKIADCGQRPIGDSQRKPNRRQRGKPTEPTIHAWIQKKLQVTESDMSAAGTAKLVSQREEGATNSGKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.59
3 0.65
4 0.71
5 0.75
6 0.76
7 0.78
8 0.84
9 0.84
10 0.85
11 0.86
12 0.87
13 0.85
14 0.81
15 0.73
16 0.68
17 0.61
18 0.53
19 0.49
20 0.43
21 0.37
22 0.32
23 0.32
24 0.3
25 0.26
26 0.26
27 0.22
28 0.24
29 0.23
30 0.21
31 0.2
32 0.17
33 0.16
34 0.14
35 0.12
36 0.08
37 0.07
38 0.06
39 0.06
40 0.11
41 0.12
42 0.14
43 0.15
44 0.17
45 0.18
46 0.2
47 0.2
48 0.22