FuNGI

W3WWI3

Protein Details

Accession

W3WWI3

Localization Confidence

Medium

Confidence Score

11.6

NoLS Segment(s)

Position	Sequence	Protein Nature
216-236	GCRVRIRRDVRMRRRENKGAA	Basic
487-506	ERDSMKHSRKRSFRSLVDNE	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 18, cyto_nucl 12, mito 5, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR021740 Velvet IPR037525 Velvet_dom IPR038491 Velvet_dom_sf
Gene Ontology	GO:0005634 C:nucleus GO:0030435 P:sporulation resulting in formation of a cellular spore
KEGG	pfy:PFICI_11371 -
Pfam	View protein in Pfam PF11754 Velvet
PROSITE	View protein in PROSITE PS51821 VELVET

Amino Acid Sequences

MATHIHKAGDPLSHQQWSRQTRAGKRIHYDLMVIQQPERARACGSGPKSSADRRPVDPPPIVRLTVWEGETMAEAKDVTMDYNSDFFLFVSLENARPMAHGRVQTPAATSPPVLTGVPVSACCYLDRPSPAGYFLFPDLSVRHEGRYKLIFRLYERNKDAQDLNPIDQGDNMEDEDGLFFTFLNEVRSQPFTVFSAKKFPGLAESTPLSRTVAEQGCRVRIRRDVRMRRRENKGAAQTNDYEQRDEEYAKDRRTQSPADAYRNRSLSSASDRRASGFDHHPPPPALAPSQRLLSFAAPTYNKPYQPAPPAPALHSEPVSPAAHTPSYRHNSFASSSAYPPTPTYGHPYGDRTASHVVEDRRSSLTYPSMPAQPVSAYGPPLQPRPPMPPIDTGFRRDSQLPPMIKPELPSPTTSLIPSSSSSISGTIISSLKRSYEESNDGEYSVDDLKSHLVYKRAGGNGSEKESPGYMGDDLRVAIDPQLRAEDERDSMKHSRKRSFRSLVDNELR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.38
2	0.42
3	0.48
4	0.5
5	0.53
6	0.53
7	0.56
8	0.59
9	0.69
10	0.71
11	0.69
12	0.68
13	0.69
14	0.67
15	0.59
16	0.52
17	0.45
18	0.44
19	0.41
20	0.36
21	0.3
22	0.29
23	0.29
24	0.33
25	0.32
26	0.26
27	0.23
28	0.23
29	0.27
30	0.32
31	0.35
32	0.36
33	0.36
34	0.38
35	0.42
36	0.47
37	0.51
38	0.51
39	0.52
40	0.48
41	0.54
42	0.56
43	0.58
44	0.57
45	0.52
46	0.51
47	0.5
48	0.47
49	0.39
50	0.37
51	0.35
52	0.34
53	0.31
54	0.24
55	0.2
56	0.19
57	0.21
58	0.18
59	0.12
60	0.09
61	0.08
62	0.07
63	0.09
64	0.08
65	0.08
66	0.08
67	0.09
68	0.1
69	0.11
70	0.11
71	0.1
72	0.1
73	0.09
74	0.1
75	0.09
76	0.08
77	0.1
78	0.11
79	0.12
80	0.12
81	0.12
82	0.11
83	0.12
84	0.15
85	0.16
86	0.19
87	0.21
88	0.22
89	0.26
90	0.27
91	0.27
92	0.27
93	0.24
94	0.21
95	0.19
96	0.18
97	0.15
98	0.14
99	0.15
100	0.13
101	0.11
102	0.1
103	0.1
104	0.11
105	0.1
106	0.12
107	0.11
108	0.12
109	0.12
110	0.14
111	0.15
112	0.18
113	0.21
114	0.21
115	0.22
116	0.22
117	0.23
118	0.22
119	0.2
120	0.18
121	0.16
122	0.15
123	0.12
124	0.13
125	0.12
126	0.14
127	0.18
128	0.16
129	0.18
130	0.21
131	0.22
132	0.25
133	0.31
134	0.3
135	0.3
136	0.33
137	0.33
138	0.33
139	0.42
140	0.44
141	0.47
142	0.48
143	0.49
144	0.46
145	0.46
146	0.45
147	0.38
148	0.41
149	0.35
150	0.32
151	0.3
152	0.3
153	0.27
154	0.25
155	0.23
156	0.14
157	0.12
158	0.11
159	0.08
160	0.07
161	0.07
162	0.07
163	0.06
164	0.05
165	0.04
166	0.04
167	0.04
168	0.05
169	0.06
170	0.08
171	0.09
172	0.1
173	0.12
174	0.14
175	0.15
176	0.14
177	0.15
178	0.13
179	0.19
180	0.2
181	0.19
182	0.25
183	0.25
184	0.26
185	0.25
186	0.24
187	0.22
188	0.23
189	0.22
190	0.18
191	0.18
192	0.18
193	0.18
194	0.19
195	0.15
196	0.12
197	0.12
198	0.15
199	0.18
200	0.18
201	0.21
202	0.22
203	0.27
204	0.29
205	0.3
206	0.26
207	0.3
208	0.34
209	0.4
210	0.5
211	0.55
212	0.63
213	0.73
214	0.79
215	0.8
216	0.83
217	0.8
218	0.75
219	0.72
220	0.7
221	0.66
222	0.58
223	0.53
224	0.46
225	0.41
226	0.43
227	0.35
228	0.27
229	0.2
230	0.2
231	0.18
232	0.18
233	0.16
234	0.17
235	0.21
236	0.22
237	0.28
238	0.29
239	0.31
240	0.35
241	0.35
242	0.3
243	0.35
244	0.38
245	0.41
246	0.43
247	0.44
248	0.44
249	0.44
250	0.42
251	0.33
252	0.29
253	0.23
254	0.27
255	0.28
256	0.25
257	0.27
258	0.27
259	0.28
260	0.28
261	0.27
262	0.23
263	0.22
264	0.27
265	0.29
266	0.3
267	0.31
268	0.3
269	0.3
270	0.27
271	0.23
272	0.19
273	0.16
274	0.18
275	0.17
276	0.19
277	0.18
278	0.18
279	0.17
280	0.16
281	0.15
282	0.13
283	0.16
284	0.14
285	0.15
286	0.21
287	0.23
288	0.23
289	0.24
290	0.26
291	0.27
292	0.33
293	0.35
294	0.31
295	0.32
296	0.33
297	0.32
298	0.34
299	0.31
300	0.25
301	0.22
302	0.19
303	0.15
304	0.18
305	0.17
306	0.13
307	0.12
308	0.14
309	0.15
310	0.15
311	0.16
312	0.22
313	0.28
314	0.28
315	0.29
316	0.27
317	0.27
318	0.28
319	0.3
320	0.25
321	0.2
322	0.21
323	0.21
324	0.21
325	0.2
326	0.19
327	0.18
328	0.16
329	0.15
330	0.21
331	0.22
332	0.24
333	0.25
334	0.28
335	0.27
336	0.28
337	0.27
338	0.24
339	0.24
340	0.23
341	0.22
342	0.23
343	0.23
344	0.26
345	0.27
346	0.25
347	0.23
348	0.24
349	0.24
350	0.21
351	0.24
352	0.21
353	0.22
354	0.23
355	0.24
356	0.23
357	0.23
358	0.21
359	0.17
360	0.16
361	0.17
362	0.16
363	0.14
364	0.16
365	0.2
366	0.22
367	0.25
368	0.26
369	0.26
370	0.28
371	0.33
372	0.36
373	0.36
374	0.36
375	0.4
376	0.4
377	0.46
378	0.46
379	0.44
380	0.43
381	0.4
382	0.4
383	0.36
384	0.36
385	0.34
386	0.39
387	0.36
388	0.34
389	0.38
390	0.38
391	0.36
392	0.35
393	0.33
394	0.32
395	0.31
396	0.31
397	0.29
398	0.29
399	0.29
400	0.28
401	0.24
402	0.19
403	0.19
404	0.19
405	0.18
406	0.16
407	0.16
408	0.16
409	0.15
410	0.15
411	0.13
412	0.12
413	0.12
414	0.13
415	0.13
416	0.14
417	0.14
418	0.15
419	0.16
420	0.19
421	0.2
422	0.25
423	0.31
424	0.32
425	0.37
426	0.36
427	0.34
428	0.32
429	0.27
430	0.23
431	0.19
432	0.16
433	0.11
434	0.11
435	0.13
436	0.14
437	0.17
438	0.18
439	0.2
440	0.21
441	0.25
442	0.32
443	0.33
444	0.33
445	0.32
446	0.36
447	0.37
448	0.41
449	0.39
450	0.33
451	0.31
452	0.3
453	0.28
454	0.22
455	0.19
456	0.16
457	0.15
458	0.15
459	0.14
460	0.14
461	0.14
462	0.14
463	0.12
464	0.14
465	0.17
466	0.17
467	0.18
468	0.21
469	0.21
470	0.22
471	0.24
472	0.24
473	0.23
474	0.28
475	0.27
476	0.3
477	0.36
478	0.44
479	0.49
480	0.54
481	0.61
482	0.65
483	0.73
484	0.77
485	0.79
486	0.77
487	0.81
488	0.79

W3WWI3

3D AlphaFold-predicted Structure Viewer