Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2J5U4

Protein Details
Accession A0A0A2J5U4   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-61EGRRIRKGCQRRRTQYYERRQHLBasic
63-91PITGPAAKPRVRKRKKRPRERPCFPVISVHydrophilic
NLS Segment(s)
PositionSequence
66-83GPAAKPRVRKRKKRPRER
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito_nucl 12.333, mito 3.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MRKSRQTSKTMNVEIQNDSKWVNNRVWAKEVQFDPRLGEGRRIRKGCQRRRTQYYERRQHLAPITGPAAKPRVRKRKKRPRERPCFPVISVISVFLESMNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.48
3 0.4
4 0.32
5 0.28
6 0.27
7 0.27
8 0.27
9 0.25
10 0.29
11 0.34
12 0.36
13 0.39
14 0.37
15 0.34
16 0.37
17 0.37
18 0.36
19 0.33
20 0.3
21 0.28
22 0.28
23 0.3
24 0.24
25 0.31
26 0.31
27 0.37
28 0.44
29 0.44
30 0.44
31 0.49
32 0.59
33 0.61
34 0.65
35 0.67
36 0.68
37 0.73
38 0.79
39 0.8
40 0.8
41 0.8
42 0.81
43 0.74
44 0.69
45 0.62
46 0.58
47 0.51
48 0.45
49 0.35
50 0.27
51 0.26
52 0.24
53 0.24
54 0.21
55 0.23
56 0.24
57 0.31
58 0.38
59 0.48
60 0.56
61 0.67
62 0.77
63 0.83
64 0.9
65 0.94
66 0.95
67 0.95
68 0.96
69 0.94
70 0.9
71 0.87
72 0.81
73 0.7
74 0.68
75 0.57
76 0.51
77 0.43
78 0.36
79 0.28
80 0.23
81 0.22