Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JHW5

Protein Details
Accession C4JHW5   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-36QGQHPSTSRPRMKPRLGERKIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011012  Longin-like_dom_sf  
IPR007233  TRAPPC  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005794  C:Golgi apparatus  
GO:0030008  C:TRAPP complex  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
KEGG ure:UREG_01390  -  
Pfam View protein in Pfam  
PF04099  Sybindin  
CDD cd14856  TRAPPC4_synbindin  
Amino Acid Sequences MAAGTRRSALSLQPVQGQHPSTSRPRMKPRLGERKIATWPPLRLTSRQDATVTRHQPQSGGLIYQREFQAGLQKLSTNDYLVLAGTFHGVHAITRSLTPRITSSSSTSASGPGAATPTHSSLPNPGLPKSGLEVLESEKFRLTCFQTVTGTKFLLFTDPVMPNVDPMIRKIYELYADYVMKNPFYQMEMPVRCEAFDRHLGTWLRSRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.39
4 0.38
5 0.32
6 0.3
7 0.33
8 0.34
9 0.44
10 0.5
11 0.54
12 0.62
13 0.69
14 0.74
15 0.78
16 0.82
17 0.83
18 0.79
19 0.79
20 0.71
21 0.68
22 0.67
23 0.61
24 0.56
25 0.51
26 0.49
27 0.45
28 0.49
29 0.45
30 0.42
31 0.44
32 0.47
33 0.43
34 0.43
35 0.4
36 0.35
37 0.39
38 0.45
39 0.44
40 0.39
41 0.4
42 0.38
43 0.36
44 0.34
45 0.32
46 0.23
47 0.21
48 0.18
49 0.19
50 0.19
51 0.22
52 0.21
53 0.17
54 0.16
55 0.14
56 0.21
57 0.2
58 0.2
59 0.17
60 0.19
61 0.19
62 0.21
63 0.21
64 0.13
65 0.11
66 0.11
67 0.1
68 0.09
69 0.08
70 0.06
71 0.05
72 0.05
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.06
80 0.06
81 0.07
82 0.09
83 0.1
84 0.1
85 0.11
86 0.11
87 0.13
88 0.15
89 0.15
90 0.17
91 0.19
92 0.19
93 0.2
94 0.19
95 0.16
96 0.14
97 0.13
98 0.1
99 0.07
100 0.07
101 0.06
102 0.07
103 0.08
104 0.09
105 0.1
106 0.1
107 0.11
108 0.12
109 0.15
110 0.18
111 0.18
112 0.17
113 0.18
114 0.18
115 0.18
116 0.17
117 0.18
118 0.14
119 0.13
120 0.13
121 0.14
122 0.19
123 0.19
124 0.18
125 0.17
126 0.17
127 0.17
128 0.2
129 0.21
130 0.2
131 0.21
132 0.23
133 0.25
134 0.27
135 0.3
136 0.28
137 0.25
138 0.21
139 0.19
140 0.17
141 0.16
142 0.14
143 0.12
144 0.16
145 0.16
146 0.17
147 0.2
148 0.19
149 0.17
150 0.18
151 0.2
152 0.14
153 0.15
154 0.2
155 0.17
156 0.18
157 0.19
158 0.19
159 0.2
160 0.21
161 0.22
162 0.21
163 0.22
164 0.22
165 0.25
166 0.24
167 0.22
168 0.2
169 0.18
170 0.15
171 0.17
172 0.18
173 0.19
174 0.27
175 0.29
176 0.33
177 0.35
178 0.34
179 0.32
180 0.33
181 0.3
182 0.27
183 0.32
184 0.32
185 0.29
186 0.36
187 0.38
188 0.39