Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2IY96

Protein Details
Accession A0A0A2IY96    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-65SYTQCRDKSRAKGRPPSSRPRSKLHydrophilic
NLS Segment(s)
PositionSequence
49-64KSRAKGRPPSSRPRSK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MCLEAEETRYIWFADIEAATKHSRAHVPSVHPERLTQPSIKSYTQCRDKSRAKGRPPSSRPRSKLYSKLEQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.11
4 0.11
5 0.13
6 0.13
7 0.14
8 0.14
9 0.14
10 0.17
11 0.17
12 0.22
13 0.23
14 0.26
15 0.35
16 0.41
17 0.41
18 0.38
19 0.37
20 0.35
21 0.35
22 0.33
23 0.25
24 0.21
25 0.22
26 0.26
27 0.26
28 0.25
29 0.26
30 0.32
31 0.4
32 0.44
33 0.45
34 0.5
35 0.57
36 0.65
37 0.7
38 0.71
39 0.71
40 0.75
41 0.79
42 0.81
43 0.82
44 0.82
45 0.82
46 0.83
47 0.79
48 0.76
49 0.76
50 0.73
51 0.76
52 0.73