Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2JUV4

Protein Details
Accession A0A0A2JUV4   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
163-192PQAFNRPKTRKEFDKRRRRQKVYVIPRNLSHydrophilic
NLS Segment(s)
PositionSequence
168-184RPKTRKEFDKRRRRQKV
Subcellular Location(s) nucl 10, cyto 7.5, cyto_mito 7.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045851  AMP-bd_C_sf  
IPR000873  AMP-dep_Synth/Lig_com  
IPR042099  ANL_N_sf  
Gene Ontology GO:0016874  F:ligase activity  
Pfam View protein in Pfam  
PF00501  AMP-binding  
Amino Acid Sequences MGPQLQRLAESKLKCKISQAWGLTETTGAVTWLPWDREDTTGSTSQLLPNTRLKIVDGSERPVQDGHSGEILVRGPNVMLGYWENKEVTAQAFTADGWFRTGDIGTRKDGKFYIVDRKKELIKFKGLQVAPADIEAVLIEHDQILDAGVVGIPDPQLAGNEIPQAFNRPKTRKEFDKRRRRQKVYVIPRNLSGKILRRKLVQFEEHERPLKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.49
4 0.5
5 0.54
6 0.51
7 0.47
8 0.45
9 0.45
10 0.4
11 0.32
12 0.25
13 0.16
14 0.13
15 0.09
16 0.07
17 0.06
18 0.09
19 0.13
20 0.14
21 0.14
22 0.17
23 0.19
24 0.21
25 0.23
26 0.22
27 0.22
28 0.24
29 0.24
30 0.22
31 0.21
32 0.21
33 0.24
34 0.24
35 0.23
36 0.26
37 0.28
38 0.27
39 0.27
40 0.26
41 0.24
42 0.24
43 0.29
44 0.25
45 0.27
46 0.29
47 0.29
48 0.29
49 0.26
50 0.25
51 0.2
52 0.19
53 0.16
54 0.13
55 0.12
56 0.11
57 0.13
58 0.13
59 0.1
60 0.08
61 0.07
62 0.06
63 0.07
64 0.07
65 0.05
66 0.05
67 0.07
68 0.09
69 0.1
70 0.11
71 0.1
72 0.1
73 0.1
74 0.1
75 0.09
76 0.08
77 0.07
78 0.07
79 0.07
80 0.07
81 0.08
82 0.08
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.12
91 0.13
92 0.14
93 0.2
94 0.2
95 0.21
96 0.21
97 0.2
98 0.19
99 0.2
100 0.29
101 0.3
102 0.32
103 0.34
104 0.36
105 0.39
106 0.41
107 0.45
108 0.37
109 0.38
110 0.38
111 0.37
112 0.43
113 0.38
114 0.36
115 0.31
116 0.28
117 0.21
118 0.19
119 0.17
120 0.09
121 0.09
122 0.06
123 0.05
124 0.04
125 0.04
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.03
140 0.03
141 0.04
142 0.04
143 0.04
144 0.06
145 0.07
146 0.07
147 0.12
148 0.12
149 0.13
150 0.13
151 0.19
152 0.2
153 0.27
154 0.35
155 0.37
156 0.44
157 0.52
158 0.59
159 0.64
160 0.73
161 0.77
162 0.79
163 0.84
164 0.88
165 0.91
166 0.94
167 0.91
168 0.9
169 0.89
170 0.9
171 0.9
172 0.89
173 0.86
174 0.77
175 0.75
176 0.71
177 0.61
178 0.53
179 0.48
180 0.47
181 0.49
182 0.53
183 0.52
184 0.53
185 0.57
186 0.62
187 0.64
188 0.62
189 0.59
190 0.6
191 0.65
192 0.65