Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JKF8

Protein Details
Accession C4JKF8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
97-133AAEKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKDKKBasic
NLS Segment(s)
PositionSequence
96-133GAAEKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKDKK
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ure:UREG_02115  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADTPVTLRTRKFLRNPLLSRKQMVVDILHPNRANISKDDLRAKLAELYKSNKDQVSVFGLRTQYGGGKTTGFALIYDSGEALKKFEPRYRLVRIGAAEKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.71
4 0.76
5 0.79
6 0.74
7 0.69
8 0.61
9 0.54
10 0.45
11 0.4
12 0.31
13 0.26
14 0.32
15 0.31
16 0.34
17 0.32
18 0.3
19 0.32
20 0.33
21 0.31
22 0.23
23 0.29
24 0.27
25 0.31
26 0.36
27 0.33
28 0.32
29 0.3
30 0.29
31 0.27
32 0.26
33 0.26
34 0.24
35 0.28
36 0.3
37 0.32
38 0.34
39 0.28
40 0.26
41 0.23
42 0.22
43 0.24
44 0.21
45 0.19
46 0.19
47 0.19
48 0.18
49 0.18
50 0.16
51 0.11
52 0.1
53 0.11
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.08
60 0.07
61 0.07
62 0.08
63 0.08
64 0.07
65 0.07
66 0.06
67 0.08
68 0.08
69 0.08
70 0.09
71 0.13
72 0.15
73 0.19
74 0.23
75 0.26
76 0.33
77 0.38
78 0.41
79 0.38
80 0.39
81 0.38
82 0.37
83 0.34
84 0.3
85 0.25
86 0.21
87 0.22
88 0.2
89 0.19
90 0.22
91 0.3
92 0.38
93 0.47
94 0.57
95 0.65
96 0.75
97 0.85
98 0.9
99 0.91
100 0.93
101 0.94
102 0.95
103 0.95
104 0.94
105 0.94
106 0.92
107 0.91
108 0.88
109 0.87
110 0.87
111 0.87
112 0.84
113 0.85