Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JZC5

Protein Details
Accession C4JZC5    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
97-127IASRRILPRPKRSNRSRTKLTQKRPRSRTLTHydrophilic
NLS Segment(s)
PositionSequence
100-123RRILPRPKRSNRSRTKLTQKRPRS
Subcellular Location(s) mito 13.5, mito_nucl 9.333, cyto 8.5, cyto_nucl 6.833, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ure:UREG_07526  -  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
Amino Acid Sequences MAALNKIAANSPSRQNPSELETALANALSDLETNTPDLKAALRPLQFVSAREIEVGHGKKAVVIFVPVPLLQGFHKVQQRLTRELEKKFSDRQVIIIASRRILPRPKRSNRSRTKLTQKRPRSRTLTAVHDAILTDIVYPVEIVGKRLRTKEDGSKVLKVILHEKERGGVDHRLDAYGEVYRRLTGRGVGFEFPQSSAVEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.4
4 0.42
5 0.43
6 0.36
7 0.29
8 0.24
9 0.23
10 0.21
11 0.18
12 0.12
13 0.07
14 0.07
15 0.06
16 0.06
17 0.06
18 0.07
19 0.07
20 0.09
21 0.1
22 0.1
23 0.1
24 0.1
25 0.1
26 0.12
27 0.16
28 0.21
29 0.21
30 0.22
31 0.23
32 0.28
33 0.28
34 0.27
35 0.28
36 0.24
37 0.23
38 0.22
39 0.21
40 0.16
41 0.22
42 0.22
43 0.17
44 0.17
45 0.16
46 0.17
47 0.17
48 0.17
49 0.1
50 0.1
51 0.09
52 0.09
53 0.1
54 0.09
55 0.09
56 0.08
57 0.09
58 0.08
59 0.12
60 0.12
61 0.17
62 0.21
63 0.21
64 0.24
65 0.3
66 0.34
67 0.34
68 0.37
69 0.41
70 0.42
71 0.44
72 0.47
73 0.44
74 0.43
75 0.42
76 0.41
77 0.37
78 0.32
79 0.3
80 0.27
81 0.25
82 0.22
83 0.23
84 0.2
85 0.16
86 0.19
87 0.18
88 0.18
89 0.25
90 0.31
91 0.37
92 0.47
93 0.55
94 0.63
95 0.71
96 0.79
97 0.82
98 0.83
99 0.79
100 0.78
101 0.8
102 0.8
103 0.81
104 0.81
105 0.82
106 0.84
107 0.82
108 0.82
109 0.78
110 0.72
111 0.7
112 0.64
113 0.6
114 0.53
115 0.48
116 0.39
117 0.32
118 0.29
119 0.2
120 0.15
121 0.08
122 0.06
123 0.05
124 0.05
125 0.05
126 0.04
127 0.04
128 0.08
129 0.08
130 0.1
131 0.13
132 0.19
133 0.22
134 0.25
135 0.28
136 0.29
137 0.34
138 0.41
139 0.45
140 0.48
141 0.49
142 0.51
143 0.48
144 0.47
145 0.43
146 0.35
147 0.35
148 0.34
149 0.34
150 0.33
151 0.33
152 0.34
153 0.33
154 0.33
155 0.31
156 0.29
157 0.26
158 0.3
159 0.3
160 0.27
161 0.26
162 0.24
163 0.21
164 0.21
165 0.2
166 0.17
167 0.17
168 0.18
169 0.19
170 0.2
171 0.19
172 0.19
173 0.22
174 0.25
175 0.27
176 0.28
177 0.28
178 0.3
179 0.3
180 0.25
181 0.24