Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2KG70

Protein Details
Accession A0A0A2KG70   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
24-51PDPRNYTEIPKQKRKRPAHQDSNQRPVKHydrophilic
NLS Segment(s)
PositionSequence
34-42KQKRKRPAH
48-56RPVKVPKQS
58-59PK
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MLPKPCPRTTNFILWRFLEEMETPDPRNYTEIPKQKRKRPAHQDSNQRPVKVPKQSIPKTPQPRRMMTRSRKSGDLLGPSPTTVPPGSHSPPSPAPKTPKSAQYNGCRYRKRRFELWVQKMLKSESDPTKKQEVLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.46
4 0.41
5 0.32
6 0.24
7 0.23
8 0.22
9 0.24
10 0.22
11 0.22
12 0.23
13 0.21
14 0.24
15 0.22
16 0.25
17 0.32
18 0.4
19 0.47
20 0.57
21 0.65
22 0.7
23 0.79
24 0.8
25 0.82
26 0.83
27 0.85
28 0.86
29 0.85
30 0.88
31 0.86
32 0.86
33 0.79
34 0.69
35 0.6
36 0.56
37 0.56
38 0.52
39 0.49
40 0.45
41 0.51
42 0.54
43 0.59
44 0.59
45 0.61
46 0.63
47 0.67
48 0.7
49 0.65
50 0.67
51 0.65
52 0.67
53 0.67
54 0.66
55 0.68
56 0.66
57 0.63
58 0.59
59 0.54
60 0.51
61 0.44
62 0.39
63 0.3
64 0.26
65 0.23
66 0.22
67 0.21
68 0.17
69 0.16
70 0.11
71 0.1
72 0.11
73 0.16
74 0.19
75 0.21
76 0.22
77 0.24
78 0.3
79 0.35
80 0.36
81 0.36
82 0.41
83 0.42
84 0.48
85 0.48
86 0.51
87 0.52
88 0.56
89 0.58
90 0.61
91 0.67
92 0.69
93 0.75
94 0.73
95 0.72
96 0.75
97 0.77
98 0.74
99 0.71
100 0.68
101 0.71
102 0.74
103 0.77
104 0.76
105 0.69
106 0.65
107 0.61
108 0.57
109 0.48
110 0.4
111 0.4
112 0.4
113 0.47
114 0.48
115 0.5
116 0.56
117 0.54