Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2JQ92

Protein Details
Accession A0A0A2JQ92    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
211-230LPKKFDQKKILKVIKKKFACHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, plas 7, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005351  ASTER  
IPR001950  SUI1  
IPR036877  SUI1_dom_sf  
IPR005874  SUI1_euk  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:1990904  C:ribonucleoprotein complex  
GO:0044183  F:protein folding chaperone  
GO:0003743  F:translation initiation factor activity  
GO:0045048  P:protein insertion into ER membrane  
Pfam View protein in Pfam  
PF03669  ASTER  
PF01253  SUI1  
PROSITE View protein in PROSITE  
PS50296  SUI1  
CDD cd11566  eIF1_SUI1  
Amino Acid Sequences MSSKKDMRRADLAIPYVDPPKSSSDADISSTPHLRRFSNGTMSSTMPMAAMFTRNRMIGWVSFVFSLQSWLGESPEQKKTASTPAYMSVFMSLMALVVTYFPLFLPPQAPGGSATSSLPFFYHSISSPLTTHAPIFYRDIESRPSLTPSIPILNAVYYEKAEFMSIENLKTFDPFAEADEDTGETKQSQNYIHIRIQQRNGRKTLTTVQGLPKKFDQKKILKVIKKKFACNGTIVSDTEMGEVIQLQGDQRKDVQEFLTDKKEGLELDAKTIKVHGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.35
4 0.31
5 0.25
6 0.21
7 0.23
8 0.25
9 0.25
10 0.25
11 0.25
12 0.26
13 0.28
14 0.28
15 0.26
16 0.27
17 0.31
18 0.3
19 0.31
20 0.32
21 0.3
22 0.32
23 0.37
24 0.38
25 0.42
26 0.43
27 0.41
28 0.41
29 0.41
30 0.38
31 0.31
32 0.25
33 0.16
34 0.13
35 0.11
36 0.09
37 0.12
38 0.12
39 0.14
40 0.16
41 0.16
42 0.16
43 0.17
44 0.18
45 0.14
46 0.19
47 0.17
48 0.16
49 0.16
50 0.16
51 0.15
52 0.13
53 0.15
54 0.1
55 0.09
56 0.09
57 0.09
58 0.1
59 0.12
60 0.14
61 0.17
62 0.22
63 0.23
64 0.22
65 0.23
66 0.24
67 0.3
68 0.3
69 0.26
70 0.23
71 0.26
72 0.28
73 0.27
74 0.25
75 0.17
76 0.15
77 0.13
78 0.11
79 0.07
80 0.05
81 0.04
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.05
90 0.05
91 0.06
92 0.07
93 0.07
94 0.09
95 0.1
96 0.1
97 0.1
98 0.11
99 0.11
100 0.11
101 0.11
102 0.1
103 0.1
104 0.09
105 0.08
106 0.08
107 0.08
108 0.08
109 0.09
110 0.09
111 0.11
112 0.12
113 0.13
114 0.11
115 0.13
116 0.13
117 0.12
118 0.12
119 0.11
120 0.11
121 0.12
122 0.13
123 0.12
124 0.14
125 0.14
126 0.15
127 0.17
128 0.17
129 0.18
130 0.16
131 0.18
132 0.15
133 0.15
134 0.15
135 0.14
136 0.15
137 0.12
138 0.12
139 0.1
140 0.1
141 0.1
142 0.09
143 0.09
144 0.07
145 0.07
146 0.07
147 0.07
148 0.07
149 0.06
150 0.06
151 0.12
152 0.12
153 0.13
154 0.13
155 0.13
156 0.13
157 0.14
158 0.13
159 0.07
160 0.08
161 0.08
162 0.09
163 0.11
164 0.11
165 0.11
166 0.11
167 0.12
168 0.11
169 0.1
170 0.1
171 0.07
172 0.08
173 0.09
174 0.11
175 0.11
176 0.17
177 0.21
178 0.26
179 0.29
180 0.35
181 0.4
182 0.43
183 0.5
184 0.51
185 0.56
186 0.57
187 0.57
188 0.52
189 0.47
190 0.46
191 0.45
192 0.45
193 0.38
194 0.36
195 0.41
196 0.45
197 0.45
198 0.44
199 0.43
200 0.47
201 0.49
202 0.54
203 0.55
204 0.57
205 0.65
206 0.72
207 0.76
208 0.73
209 0.79
210 0.8
211 0.8
212 0.77
213 0.73
214 0.7
215 0.67
216 0.62
217 0.55
218 0.49
219 0.43
220 0.41
221 0.36
222 0.31
223 0.26
224 0.23
225 0.2
226 0.17
227 0.12
228 0.09
229 0.09
230 0.07
231 0.06
232 0.06
233 0.07
234 0.12
235 0.13
236 0.15
237 0.17
238 0.22
239 0.22
240 0.24
241 0.25
242 0.27
243 0.3
244 0.34
245 0.38
246 0.34
247 0.33
248 0.32
249 0.32
250 0.25
251 0.26
252 0.27
253 0.21
254 0.28
255 0.32
256 0.31
257 0.29