Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JUL0

Protein Details
Accession C4JUL0   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MELSELEKKRRRERKDYPYRLEYRTBasic
NLS Segment(s)
PositionSequence
8-14KKRRRER
Subcellular Location(s) nucl 16, cyto_nucl 14.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR029069  HotDog_dom_sf  
IPR006683  Thioestr_dom  
KEGG ure:UREG_04813  -  
Pfam View protein in Pfam  
PF03061  4HBT  
CDD cd00586  4HBT  
Amino Acid Sequences MELSELEKKRRRERKDYPYRLEYRTRWSDNDMYAHMNNSIYAFLFDSIINTYLIERCGLDPFSSRSRSPEPSNPQSAISEPLPTSPQIGLVVSSYCDFFASVSFPDVLELGLRVTKLGKSSVTYEVGVFRKGENAVKVVGGFTHVFVDKATMKPTTTGMIPSIRAGLQRLLVSNELESKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.88
3 0.9
4 0.88
5 0.88
6 0.85
7 0.8
8 0.78
9 0.7
10 0.68
11 0.66
12 0.62
13 0.54
14 0.54
15 0.54
16 0.48
17 0.48
18 0.41
19 0.36
20 0.33
21 0.31
22 0.26
23 0.21
24 0.18
25 0.15
26 0.13
27 0.09
28 0.09
29 0.08
30 0.08
31 0.09
32 0.08
33 0.08
34 0.09
35 0.1
36 0.09
37 0.08
38 0.09
39 0.09
40 0.1
41 0.09
42 0.09
43 0.09
44 0.11
45 0.11
46 0.11
47 0.12
48 0.16
49 0.21
50 0.23
51 0.23
52 0.26
53 0.3
54 0.34
55 0.36
56 0.41
57 0.44
58 0.47
59 0.51
60 0.47
61 0.43
62 0.39
63 0.35
64 0.29
65 0.21
66 0.17
67 0.13
68 0.13
69 0.13
70 0.12
71 0.13
72 0.09
73 0.1
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.06
80 0.06
81 0.06
82 0.05
83 0.05
84 0.05
85 0.04
86 0.05
87 0.06
88 0.06
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.06
95 0.05
96 0.05
97 0.04
98 0.05
99 0.05
100 0.05
101 0.06
102 0.07
103 0.08
104 0.1
105 0.1
106 0.11
107 0.15
108 0.18
109 0.19
110 0.19
111 0.18
112 0.22
113 0.23
114 0.22
115 0.19
116 0.16
117 0.17
118 0.18
119 0.2
120 0.17
121 0.17
122 0.16
123 0.16
124 0.16
125 0.13
126 0.11
127 0.11
128 0.1
129 0.09
130 0.11
131 0.11
132 0.11
133 0.11
134 0.15
135 0.15
136 0.16
137 0.18
138 0.17
139 0.18
140 0.19
141 0.2
142 0.19
143 0.17
144 0.17
145 0.18
146 0.19
147 0.19
148 0.19
149 0.2
150 0.18
151 0.19
152 0.19
153 0.18
154 0.19
155 0.2
156 0.2
157 0.22
158 0.22
159 0.22
160 0.22