Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2K812

Protein Details
Accession A0A0A2K812   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-88GWLCCNKQKKGDKPKEDEPREAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 7, E.R. 5, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MMTTTTTTIFRTVVKEVSAASSPAPSATSTSSTPSNSSAAMSNLAMVPPGLWAVIIFVLCVAVGGIGWLCCNKQKKGDKPKEDEPREAEGTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.17
4 0.19
5 0.18
6 0.16
7 0.13
8 0.12
9 0.11
10 0.11
11 0.11
12 0.08
13 0.09
14 0.1
15 0.13
16 0.12
17 0.15
18 0.17
19 0.17
20 0.18
21 0.18
22 0.17
23 0.14
24 0.14
25 0.13
26 0.11
27 0.11
28 0.1
29 0.09
30 0.08
31 0.07
32 0.07
33 0.05
34 0.04
35 0.03
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.02
50 0.02
51 0.02
52 0.03
53 0.03
54 0.03
55 0.04
56 0.05
57 0.11
58 0.17
59 0.2
60 0.29
61 0.39
62 0.5
63 0.61
64 0.71
65 0.75
66 0.78
67 0.86
68 0.87
69 0.83
70 0.8
71 0.73
72 0.7