FuNGI

A0A0A2JBI6

Protein Details

Accession

A0A0A2JBI6

Localization Confidence

Medium

Confidence Score

11.3

NoLS Segment(s)

Position	Sequence	Protein Nature
26-55	SWDSCMDKSYCKRRNKTPKHFDDPPFHQPP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 25, cyto_nucl 14.5

Family & Domain DBs

InterPro	View protein in InterPro IPR037504 PSI_induc_2

Amino Acid Sequences

MSPANITLWVRDTASDLESVPSTFSSWDSCMDKSYCKRRNKTPKHFDDPPFHQPPPPAPNPVYQAPPAPPAYRGAQQTAHFDAPKSPAAHVNEDALPEMPTWAGAIDKHVEDPNHHDDVEMEPLNPPDRRQGAGTPGAAYADYPPNPAMGAAAVGYRGFGPTDPRARRSPGPGAALNPIQDPYGRRSPGMPSSGAAMDPYGRRSPGPAALAAKDPYGRRSPGPAAVLAVSQDPYGRRSPGMSPSAPAAGYGAAAHNPYGSHSHGAPVHNPYDQQPYQDSYHDHSYDDHSYGAGNDYHAVTAPSPVAAYKPHTNYSPVPMAFSPSSDIDHSAAAVAPTPGFQRQPSFGSSQYPPTYTSQPSYRAFSPGAPSSPPPAFSAPSPSEYTTYNPHANTTPMPEPDNTRPPSLLQSGKKPTVNAYSNF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.2
2	0.19
3	0.16
4	0.17
5	0.17
6	0.17
7	0.14
8	0.13
9	0.12
10	0.12
11	0.12
12	0.14
13	0.14
14	0.19
15	0.21
16	0.21
17	0.26
18	0.27
19	0.34
20	0.4
21	0.5
22	0.54
23	0.61
24	0.69
25	0.75
26	0.84
27	0.87
28	0.89
29	0.89
30	0.91
31	0.89
32	0.91
33	0.87
34	0.85
35	0.82
36	0.8
37	0.76
38	0.67
39	0.61
40	0.54
41	0.55
42	0.54
43	0.51
44	0.47
45	0.42
46	0.46
47	0.49
48	0.49
49	0.45
50	0.38
51	0.37
52	0.33
53	0.36
54	0.34
55	0.3
56	0.27
57	0.27
58	0.29
59	0.3
60	0.31
61	0.29
62	0.31
63	0.32
64	0.36
65	0.37
66	0.37
67	0.32
68	0.31
69	0.31
70	0.29
71	0.32
72	0.29
73	0.25
74	0.28
75	0.31
76	0.35
77	0.32
78	0.32
79	0.27
80	0.27
81	0.26
82	0.2
83	0.17
84	0.13
85	0.12
86	0.08
87	0.07
88	0.06
89	0.06
90	0.06
91	0.05
92	0.08
93	0.1
94	0.1
95	0.13
96	0.15
97	0.16
98	0.17
99	0.24
100	0.27
101	0.27
102	0.26
103	0.24
104	0.22
105	0.24
106	0.28
107	0.22
108	0.16
109	0.15
110	0.17
111	0.2
112	0.2
113	0.19
114	0.2
115	0.21
116	0.23
117	0.24
118	0.25
119	0.27
120	0.31
121	0.31
122	0.25
123	0.22
124	0.21
125	0.19
126	0.16
127	0.13
128	0.13
129	0.13
130	0.13
131	0.13
132	0.13
133	0.13
134	0.13
135	0.1
136	0.06
137	0.06
138	0.04
139	0.04
140	0.04
141	0.04
142	0.05
143	0.04
144	0.05
145	0.05
146	0.05
147	0.09
148	0.14
149	0.24
150	0.26
151	0.3
152	0.32
153	0.37
154	0.39
155	0.41
156	0.43
157	0.38
158	0.39
159	0.37
160	0.36
161	0.34
162	0.32
163	0.27
164	0.21
165	0.16
166	0.12
167	0.12
168	0.12
169	0.15
170	0.21
171	0.21
172	0.21
173	0.22
174	0.25
175	0.29
176	0.29
177	0.24
178	0.17
179	0.19
180	0.19
181	0.17
182	0.14
183	0.09
184	0.09
185	0.09
186	0.11
187	0.1
188	0.1
189	0.1
190	0.12
191	0.14
192	0.15
193	0.16
194	0.15
195	0.16
196	0.16
197	0.18
198	0.17
199	0.16
200	0.15
201	0.14
202	0.15
203	0.17
204	0.17
205	0.16
206	0.2
207	0.21
208	0.22
209	0.23
210	0.2
211	0.18
212	0.17
213	0.16
214	0.12
215	0.11
216	0.07
217	0.06
218	0.07
219	0.07
220	0.09
221	0.11
222	0.11
223	0.11
224	0.13
225	0.16
226	0.21
227	0.25
228	0.22
229	0.22
230	0.22
231	0.23
232	0.2
233	0.18
234	0.12
235	0.07
236	0.07
237	0.06
238	0.06
239	0.05
240	0.06
241	0.06
242	0.06
243	0.05
244	0.07
245	0.09
246	0.1
247	0.11
248	0.1
249	0.14
250	0.17
251	0.18
252	0.19
253	0.21
254	0.21
255	0.2
256	0.21
257	0.2
258	0.25
259	0.25
260	0.24
261	0.23
262	0.25
263	0.26
264	0.28
265	0.28
266	0.24
267	0.3
268	0.28
269	0.26
270	0.24
271	0.27
272	0.27
273	0.25
274	0.21
275	0.15
276	0.14
277	0.14
278	0.15
279	0.11
280	0.08
281	0.09
282	0.09
283	0.09
284	0.09
285	0.09
286	0.08
287	0.08
288	0.08
289	0.07
290	0.07
291	0.07
292	0.08
293	0.09
294	0.14
295	0.19
296	0.23
297	0.25
298	0.27
299	0.31
300	0.32
301	0.36
302	0.38
303	0.31
304	0.31
305	0.28
306	0.32
307	0.28
308	0.26
309	0.23
310	0.17
311	0.19
312	0.17
313	0.18
314	0.14
315	0.14
316	0.13
317	0.11
318	0.11
319	0.09
320	0.09
321	0.08
322	0.07
323	0.08
324	0.09
325	0.11
326	0.13
327	0.14
328	0.17
329	0.2
330	0.23
331	0.25
332	0.27
333	0.26
334	0.29
335	0.3
336	0.34
337	0.33
338	0.32
339	0.31
340	0.32
341	0.36
342	0.34
343	0.36
344	0.33
345	0.38
346	0.4
347	0.42
348	0.4
349	0.39
350	0.37
351	0.35
352	0.36
353	0.33
354	0.33
355	0.3
356	0.3
357	0.32
358	0.32
359	0.31
360	0.28
361	0.26
362	0.26
363	0.24
364	0.31
365	0.29
366	0.31
367	0.33
368	0.32
369	0.3
370	0.3
371	0.32
372	0.31
373	0.34
374	0.35
375	0.32
376	0.33
377	0.34
378	0.35
379	0.35
380	0.35
381	0.34
382	0.32
383	0.34
384	0.33
385	0.39
386	0.44
387	0.51
388	0.47
389	0.44
390	0.43
391	0.42
392	0.46
393	0.46
394	0.47
395	0.43
396	0.5
397	0.56
398	0.62
399	0.62
400	0.57
401	0.56
402	0.57

A0A0A2JBI6

3D AlphaFold-predicted Structure Viewer