Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JPJ0

Protein Details
Accession C4JPJ0   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
78-113SNTANRIQKKVRRKTRPSITFKPHPRKAKKATTKKRHydrophilic
NLS Segment(s)
PositionSequence
84-113IQKKVRRKTRPSITFKPHPRKAKKATTKKR
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG ure:UREG_03162  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARSSIIKRNKAKLRASVFGPVVDRRTERLSAKLQELASKTSVKDADMTDADFTLTGMDIDQTPSSSKSKSAEESNTANRIQKKVRRKTRPSITFKPHPRKAKKATTKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.75
4 0.71
5 0.66
6 0.62
7 0.58
8 0.5
9 0.44
10 0.41
11 0.34
12 0.29
13 0.28
14 0.26
15 0.22
16 0.25
17 0.27
18 0.26
19 0.29
20 0.33
21 0.33
22 0.34
23 0.35
24 0.32
25 0.32
26 0.32
27 0.29
28 0.25
29 0.23
30 0.2
31 0.2
32 0.2
33 0.16
34 0.17
35 0.15
36 0.15
37 0.14
38 0.15
39 0.11
40 0.11
41 0.1
42 0.08
43 0.07
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.05
51 0.05
52 0.05
53 0.06
54 0.09
55 0.1
56 0.11
57 0.12
58 0.14
59 0.17
60 0.2
61 0.24
62 0.25
63 0.28
64 0.32
65 0.35
66 0.36
67 0.34
68 0.36
69 0.35
70 0.36
71 0.4
72 0.44
73 0.5
74 0.57
75 0.67
76 0.73
77 0.78
78 0.84
79 0.87
80 0.89
81 0.88
82 0.87
83 0.86
84 0.85
85 0.87
86 0.87
87 0.85
88 0.85
89 0.85
90 0.85
91 0.86
92 0.87
93 0.87