Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2JU10

Protein Details
Accession A0A0A2JU10    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-42SSTLSHRPSPRQPQKPGTPPNNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007242  Atg12  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0034045  C:phagophore assembly site membrane  
GO:0000045  P:autophagosome assembly  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF04110  APG12  
CDD cd01612  Ubl_ATG12  
Amino Acid Sequences MNPSSPTRSTQSSPTQHPQSSTLSHRPSPRQPQKPGTPPNNSANAPIPDDDHGADLPMNMSASVMLTNLPRDAHQALADVESIDSGKVTVRFQPLPSAPILKNRVFKVSASQKFETVVKFLRKKLDCKETDSVFCYVNSVFAPGLDEGMGGLWRCFKTDDQLIVAYSMTPAFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.59
4 0.58
5 0.54
6 0.49
7 0.47
8 0.47
9 0.47
10 0.45
11 0.48
12 0.52
13 0.56
14 0.61
15 0.67
16 0.7
17 0.71
18 0.73
19 0.78
20 0.8
21 0.83
22 0.83
23 0.8
24 0.77
25 0.73
26 0.71
27 0.68
28 0.59
29 0.52
30 0.48
31 0.41
32 0.35
33 0.3
34 0.26
35 0.21
36 0.21
37 0.19
38 0.14
39 0.12
40 0.11
41 0.1
42 0.09
43 0.08
44 0.07
45 0.06
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.06
55 0.07
56 0.07
57 0.07
58 0.1
59 0.11
60 0.11
61 0.1
62 0.11
63 0.11
64 0.11
65 0.11
66 0.08
67 0.07
68 0.06
69 0.06
70 0.04
71 0.04
72 0.03
73 0.04
74 0.05
75 0.06
76 0.09
77 0.13
78 0.14
79 0.14
80 0.19
81 0.19
82 0.19
83 0.19
84 0.2
85 0.18
86 0.24
87 0.29
88 0.28
89 0.32
90 0.32
91 0.35
92 0.31
93 0.31
94 0.32
95 0.38
96 0.4
97 0.42
98 0.42
99 0.39
100 0.39
101 0.41
102 0.33
103 0.26
104 0.25
105 0.27
106 0.31
107 0.33
108 0.41
109 0.43
110 0.48
111 0.53
112 0.57
113 0.51
114 0.54
115 0.58
116 0.52
117 0.52
118 0.49
119 0.43
120 0.33
121 0.31
122 0.25
123 0.18
124 0.16
125 0.13
126 0.12
127 0.1
128 0.09
129 0.11
130 0.1
131 0.1
132 0.08
133 0.08
134 0.06
135 0.07
136 0.08
137 0.06
138 0.07
139 0.11
140 0.11
141 0.13
142 0.15
143 0.16
144 0.22
145 0.28
146 0.32
147 0.3
148 0.32
149 0.31
150 0.29
151 0.28
152 0.21
153 0.15