Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JYJ6

Protein Details
Accession C4JYJ6   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
280-310DGGIKRFRAFGRRKKNKCKSRRINQVIMASWHydrophilic
NLS Segment(s)
PositionSequence
284-300KRFRAFGRRKKNKCKSR
Subcellular Location(s) extr 10, mito 5, cyto 4.5, cyto_nucl 4.5, pero 4, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005164  Allantoicase  
IPR015908  Allantoicase_dom  
IPR008979  Galactose-bd-like_sf  
Gene Ontology GO:0004037  F:allantoicase activity  
GO:0000256  P:allantoin catabolic process  
KEGG ure:UREG_07247  -  
Pfam View protein in Pfam  
PF03561  Allantoicase  
Amino Acid Sequences METITDPSCIDRRFAKTTNLASAALNASILACSNEFFAAAANLLTPAAPVHRPGLFVHSGRLPFDWAIVKLGVRSAVIEGVEIDTRALCPPTTGDKRLCLLHVRLRMYPDGGIARLRLYGHALPPSLPVTITSTPLEELSSALYGALVTAASNQHFTPAANLLLPGRGINMGDGWETARSRRPGHVDWAVVRLALPGSVERIVVDTKDFRGNFPQAVRVHGIACSGPEDPAHDHPDWVEVVSGDRPCRADAEHVFDGDDLAPATRSVTGFTHLKLTMVPDGGIKRFRAFGRRKKNKCKSRRINQVIMASWFFAATSNDKTRRCNNISDHPRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.48
4 0.52
5 0.56
6 0.52
7 0.46
8 0.39
9 0.38
10 0.32
11 0.25
12 0.2
13 0.13
14 0.1
15 0.09
16 0.09
17 0.08
18 0.07
19 0.07
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.07
26 0.08
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.05
33 0.05
34 0.08
35 0.09
36 0.1
37 0.13
38 0.14
39 0.16
40 0.17
41 0.22
42 0.24
43 0.24
44 0.25
45 0.27
46 0.27
47 0.27
48 0.27
49 0.23
50 0.19
51 0.21
52 0.2
53 0.16
54 0.17
55 0.17
56 0.16
57 0.14
58 0.15
59 0.13
60 0.1
61 0.1
62 0.09
63 0.09
64 0.09
65 0.09
66 0.08
67 0.09
68 0.09
69 0.08
70 0.08
71 0.06
72 0.07
73 0.08
74 0.09
75 0.07
76 0.07
77 0.1
78 0.19
79 0.24
80 0.28
81 0.29
82 0.31
83 0.34
84 0.34
85 0.34
86 0.3
87 0.29
88 0.31
89 0.36
90 0.35
91 0.35
92 0.36
93 0.35
94 0.32
95 0.27
96 0.23
97 0.18
98 0.16
99 0.15
100 0.12
101 0.12
102 0.12
103 0.12
104 0.1
105 0.12
106 0.13
107 0.15
108 0.16
109 0.16
110 0.15
111 0.17
112 0.17
113 0.14
114 0.12
115 0.1
116 0.13
117 0.14
118 0.16
119 0.14
120 0.14
121 0.14
122 0.14
123 0.14
124 0.08
125 0.08
126 0.06
127 0.06
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.03
135 0.02
136 0.03
137 0.04
138 0.05
139 0.06
140 0.06
141 0.07
142 0.08
143 0.08
144 0.08
145 0.09
146 0.09
147 0.08
148 0.08
149 0.08
150 0.08
151 0.08
152 0.06
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.06
163 0.07
164 0.08
165 0.13
166 0.15
167 0.17
168 0.2
169 0.25
170 0.26
171 0.31
172 0.34
173 0.31
174 0.29
175 0.3
176 0.26
177 0.21
178 0.19
179 0.13
180 0.09
181 0.07
182 0.07
183 0.04
184 0.06
185 0.07
186 0.07
187 0.06
188 0.08
189 0.08
190 0.08
191 0.09
192 0.09
193 0.1
194 0.17
195 0.17
196 0.17
197 0.22
198 0.24
199 0.25
200 0.25
201 0.3
202 0.24
203 0.27
204 0.28
205 0.23
206 0.21
207 0.19
208 0.19
209 0.12
210 0.12
211 0.11
212 0.09
213 0.09
214 0.08
215 0.1
216 0.13
217 0.17
218 0.21
219 0.2
220 0.19
221 0.19
222 0.21
223 0.19
224 0.16
225 0.12
226 0.08
227 0.09
228 0.13
229 0.15
230 0.13
231 0.15
232 0.15
233 0.16
234 0.17
235 0.16
236 0.2
237 0.21
238 0.28
239 0.28
240 0.27
241 0.27
242 0.25
243 0.25
244 0.18
245 0.16
246 0.08
247 0.07
248 0.07
249 0.07
250 0.08
251 0.08
252 0.08
253 0.1
254 0.11
255 0.14
256 0.16
257 0.16
258 0.21
259 0.19
260 0.19
261 0.18
262 0.2
263 0.19
264 0.18
265 0.18
266 0.17
267 0.2
268 0.23
269 0.26
270 0.24
271 0.23
272 0.27
273 0.3
274 0.36
275 0.43
276 0.5
277 0.58
278 0.68
279 0.77
280 0.84
281 0.92
282 0.92
283 0.93
284 0.94
285 0.94
286 0.94
287 0.95
288 0.92
289 0.9
290 0.86
291 0.83
292 0.75
293 0.68
294 0.58
295 0.47
296 0.38
297 0.29
298 0.22
299 0.16
300 0.15
301 0.14
302 0.21
303 0.29
304 0.37
305 0.4
306 0.46
307 0.53
308 0.6
309 0.61
310 0.62
311 0.61
312 0.65