Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2K296

Protein Details
Accession A0A0A2K296   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
34-62NSGFRHGRVTKKRKSQRRVVNCRVQRSNMHydrophilic
NLS Segment(s)
PositionSequence
44-47KKRK
Subcellular Location(s) nucl 15, cyto_nucl 12.333, cyto 7.5, cyto_pero 4.666
Family & Domain DBs
Amino Acid Sequences MPCSKTDGLHRPSNIHLNTGAPPSVGMWVDCCCNSGFRHGRVTKKRKSQRRVVNCRVQRSNMSFGKES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.38
3 0.33
4 0.28
5 0.28
6 0.27
7 0.23
8 0.14
9 0.13
10 0.12
11 0.13
12 0.11
13 0.08
14 0.08
15 0.08
16 0.09
17 0.09
18 0.1
19 0.08
20 0.1
21 0.1
22 0.18
23 0.21
24 0.22
25 0.32
26 0.35
27 0.44
28 0.53
29 0.62
30 0.62
31 0.68
32 0.76
33 0.77
34 0.82
35 0.83
36 0.83
37 0.85
38 0.88
39 0.86
40 0.87
41 0.84
42 0.85
43 0.81
44 0.74
45 0.71
46 0.66
47 0.65
48 0.59