Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JWF0

Protein Details
Accession C4JWF0    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSTPPRRPRPKITWWMRIKHRLRYLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 13.333, nucl 11, cyto_nucl 6.833
Family & Domain DBs
KEGG ure:UREG_06892  -  
Amino Acid Sequences MSTPPRRPRPKITWWMRIKHRLRYLESPLALRGSIIRLRHRHKHPYLALLRLCMPTATFSWSYPVPTPPSPLALIENPDLGWERRYDNNIKSLETVPIWRSRDTPLRCLYRLYEAIMGGDEMLPVVGYETEYFFRQGRRAWELHRIPDPRDPDPIRYALLACILESLLDSFNWRLSIGMRRDGNHIPPTNWDGVNNPYAPYEPMTLPSWPQQVPPVDKQYLKDVMPERVIDSQGLLMLHTDGKDEIFTKRNIAATGHKFWTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.84
4 0.86
5 0.81
6 0.81
7 0.8
8 0.77
9 0.75
10 0.74
11 0.73
12 0.71
13 0.66
14 0.58
15 0.51
16 0.44
17 0.37
18 0.29
19 0.22
20 0.18
21 0.2
22 0.23
23 0.3
24 0.37
25 0.44
26 0.54
27 0.61
28 0.67
29 0.68
30 0.74
31 0.69
32 0.71
33 0.68
34 0.66
35 0.59
36 0.51
37 0.48
38 0.39
39 0.35
40 0.25
41 0.2
42 0.15
43 0.14
44 0.17
45 0.15
46 0.15
47 0.17
48 0.18
49 0.2
50 0.2
51 0.23
52 0.23
53 0.23
54 0.27
55 0.24
56 0.26
57 0.24
58 0.23
59 0.23
60 0.19
61 0.21
62 0.18
63 0.17
64 0.14
65 0.14
66 0.15
67 0.13
68 0.12
69 0.11
70 0.13
71 0.16
72 0.21
73 0.25
74 0.26
75 0.32
76 0.32
77 0.32
78 0.31
79 0.29
80 0.27
81 0.22
82 0.23
83 0.18
84 0.23
85 0.24
86 0.22
87 0.23
88 0.25
89 0.34
90 0.34
91 0.38
92 0.38
93 0.41
94 0.41
95 0.41
96 0.38
97 0.34
98 0.32
99 0.28
100 0.22
101 0.17
102 0.17
103 0.15
104 0.14
105 0.08
106 0.07
107 0.05
108 0.03
109 0.03
110 0.03
111 0.02
112 0.03
113 0.02
114 0.03
115 0.03
116 0.04
117 0.05
118 0.06
119 0.08
120 0.08
121 0.1
122 0.11
123 0.14
124 0.17
125 0.2
126 0.22
127 0.23
128 0.32
129 0.33
130 0.35
131 0.4
132 0.37
133 0.35
134 0.39
135 0.41
136 0.32
137 0.38
138 0.36
139 0.32
140 0.33
141 0.32
142 0.27
143 0.24
144 0.23
145 0.15
146 0.16
147 0.12
148 0.09
149 0.09
150 0.08
151 0.07
152 0.06
153 0.07
154 0.05
155 0.05
156 0.06
157 0.06
158 0.07
159 0.08
160 0.08
161 0.07
162 0.09
163 0.17
164 0.19
165 0.25
166 0.26
167 0.27
168 0.32
169 0.34
170 0.38
171 0.37
172 0.37
173 0.31
174 0.32
175 0.35
176 0.34
177 0.31
178 0.26
179 0.21
180 0.22
181 0.26
182 0.23
183 0.19
184 0.17
185 0.17
186 0.18
187 0.17
188 0.17
189 0.13
190 0.16
191 0.17
192 0.18
193 0.19
194 0.23
195 0.25
196 0.23
197 0.23
198 0.26
199 0.31
200 0.36
201 0.4
202 0.43
203 0.43
204 0.44
205 0.45
206 0.46
207 0.44
208 0.39
209 0.39
210 0.36
211 0.36
212 0.37
213 0.36
214 0.32
215 0.3
216 0.31
217 0.24
218 0.21
219 0.17
220 0.16
221 0.15
222 0.12
223 0.09
224 0.1
225 0.11
226 0.1
227 0.11
228 0.09
229 0.1
230 0.11
231 0.12
232 0.16
233 0.2
234 0.21
235 0.23
236 0.26
237 0.29
238 0.29
239 0.31
240 0.36
241 0.37
242 0.43