Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2K1Q4

Protein Details
Accession A0A0A2K1Q4    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
64-89FCRTRSKSHFYRLQRKPGKTRWYLCFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9
Family & Domain DBs
Amino Acid Sequences MKRPSNPVKFALSEGDIPLLQTLLSIDHIIDHSDSRAYMQYAIRLGNIEQLKILLTLMALSKGFCRTRSKSHFYRLQRKPGKTRWYLCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.19
4 0.17
5 0.15
6 0.11
7 0.08
8 0.07
9 0.06
10 0.05
11 0.06
12 0.06
13 0.06
14 0.06
15 0.07
16 0.08
17 0.08
18 0.07
19 0.07
20 0.07
21 0.07
22 0.08
23 0.09
24 0.09
25 0.11
26 0.11
27 0.12
28 0.13
29 0.13
30 0.12
31 0.11
32 0.11
33 0.14
34 0.14
35 0.12
36 0.11
37 0.11
38 0.11
39 0.1
40 0.1
41 0.04
42 0.04
43 0.04
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.13
50 0.14
51 0.17
52 0.24
53 0.28
54 0.38
55 0.47
56 0.53
57 0.55
58 0.63
59 0.69
60 0.72
61 0.78
62 0.76
63 0.79
64 0.8
65 0.82
66 0.83
67 0.83
68 0.83
69 0.82