Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JDH3

Protein Details
Accession C4JDH3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-71KSKPSRVDGRTPRRRGQIKKVKCLVSHydrophilic
NLS Segment(s)
PositionSequence
48-65KPSRVDGRTPRRRGQIKK
Subcellular Location(s) mito 15.5, cyto_mito 11, nucl 6, cyto 5.5
Family & Domain DBs
KEGG ure:UREG_00699  -  
Amino Acid Sequences MPESRERKCAWAAGPVAMHPATRVTEQQELGEREMVDSWNAGAGIKSKPSRVDGRTPRRRGQIKKVKCLVSTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.27
3 0.28
4 0.23
5 0.21
6 0.14
7 0.14
8 0.12
9 0.13
10 0.15
11 0.15
12 0.18
13 0.19
14 0.2
15 0.24
16 0.24
17 0.23
18 0.24
19 0.2
20 0.17
21 0.17
22 0.15
23 0.1
24 0.08
25 0.07
26 0.05
27 0.05
28 0.05
29 0.04
30 0.06
31 0.07
32 0.12
33 0.14
34 0.15
35 0.17
36 0.21
37 0.28
38 0.3
39 0.4
40 0.46
41 0.56
42 0.65
43 0.7
44 0.72
45 0.75
46 0.8
47 0.78
48 0.79
49 0.79
50 0.78
51 0.82
52 0.83
53 0.79