Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2IVL8

Protein Details
Accession A0A0A2IVL8   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
211-234YIQPSHEKAKREKQRKEKNFLDVDHydrophilic
NLS Segment(s)
PositionSequence
95-100RRGGRG
218-227KAKREKQRKE
241-306PRSGPAPRGRGDRAPRGDRPARGGERSERGRGGPRGGDRAPRGDRPARGGAAPAARGGAPRANARG
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006861  HABP4_PAIRBP1-bd  
IPR019084  Stm1-like_N  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF09598  Stm1_N  
Amino Acid Sequences MAESVRSKNLYELLGNDPELDPSRPAPPPTKAIDRPVDRSGKRDAPKEQPARHTEANARRGGRVTAGNEAAYRDRNAGRNNNREKPTDEAAQPARRGGRGGRGDRQSRTGQTDTRKQVQQGWGAESGEKTLDDERQGEKIAKKEENEPQTPVEAEEQEEPDNSKSFADYLAEKAQRETLAAKPERTANEGAKLDKKWAAAKELSKQEEASYIQPSHEKAKREKQRKEKNFLDVDLRYVEPPRSGPAPRGRGDRAPRGDRPARGGERSERGRGGPRGGDRAPRGDRPARGGAAPAARGGAPRANARGPAGPTVDEKNFPSLGGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.26
4 0.23
5 0.24
6 0.25
7 0.23
8 0.2
9 0.19
10 0.24
11 0.26
12 0.3
13 0.34
14 0.35
15 0.4
16 0.44
17 0.51
18 0.5
19 0.54
20 0.6
21 0.59
22 0.6
23 0.62
24 0.65
25 0.56
26 0.55
27 0.55
28 0.55
29 0.55
30 0.56
31 0.55
32 0.55
33 0.65
34 0.71
35 0.69
36 0.69
37 0.69
38 0.69
39 0.65
40 0.6
41 0.59
42 0.58
43 0.59
44 0.56
45 0.52
46 0.46
47 0.45
48 0.42
49 0.36
50 0.32
51 0.27
52 0.27
53 0.26
54 0.25
55 0.24
56 0.25
57 0.24
58 0.21
59 0.2
60 0.19
61 0.21
62 0.25
63 0.31
64 0.39
65 0.46
66 0.54
67 0.62
68 0.67
69 0.67
70 0.65
71 0.61
72 0.57
73 0.53
74 0.47
75 0.4
76 0.37
77 0.4
78 0.42
79 0.4
80 0.37
81 0.34
82 0.29
83 0.3
84 0.25
85 0.28
86 0.31
87 0.36
88 0.4
89 0.46
90 0.5
91 0.5
92 0.53
93 0.48
94 0.43
95 0.44
96 0.4
97 0.37
98 0.39
99 0.46
100 0.47
101 0.49
102 0.49
103 0.44
104 0.47
105 0.47
106 0.46
107 0.39
108 0.36
109 0.32
110 0.3
111 0.29
112 0.23
113 0.18
114 0.13
115 0.1
116 0.09
117 0.08
118 0.09
119 0.1
120 0.12
121 0.13
122 0.14
123 0.15
124 0.17
125 0.18
126 0.21
127 0.25
128 0.26
129 0.26
130 0.31
131 0.36
132 0.39
133 0.39
134 0.36
135 0.32
136 0.3
137 0.29
138 0.24
139 0.18
140 0.12
141 0.12
142 0.11
143 0.11
144 0.11
145 0.11
146 0.11
147 0.11
148 0.11
149 0.1
150 0.08
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.09
157 0.15
158 0.17
159 0.17
160 0.17
161 0.18
162 0.17
163 0.17
164 0.17
165 0.14
166 0.21
167 0.23
168 0.23
169 0.22
170 0.26
171 0.26
172 0.27
173 0.27
174 0.2
175 0.24
176 0.25
177 0.26
178 0.27
179 0.26
180 0.25
181 0.25
182 0.25
183 0.23
184 0.23
185 0.26
186 0.25
187 0.28
188 0.33
189 0.38
190 0.39
191 0.35
192 0.34
193 0.3
194 0.29
195 0.28
196 0.22
197 0.19
198 0.17
199 0.17
200 0.19
201 0.2
202 0.25
203 0.27
204 0.31
205 0.34
206 0.44
207 0.53
208 0.62
209 0.7
210 0.73
211 0.8
212 0.85
213 0.86
214 0.82
215 0.81
216 0.75
217 0.67
218 0.63
219 0.52
220 0.45
221 0.38
222 0.32
223 0.25
224 0.22
225 0.21
226 0.16
227 0.16
228 0.17
229 0.19
230 0.19
231 0.25
232 0.33
233 0.38
234 0.41
235 0.46
236 0.47
237 0.51
238 0.57
239 0.6
240 0.59
241 0.59
242 0.59
243 0.62
244 0.64
245 0.58
246 0.57
247 0.57
248 0.53
249 0.5
250 0.51
251 0.48
252 0.51
253 0.53
254 0.52
255 0.44
256 0.42
257 0.46
258 0.45
259 0.44
260 0.41
261 0.4
262 0.43
263 0.44
264 0.49
265 0.44
266 0.49
267 0.49
268 0.48
269 0.52
270 0.5
271 0.51
272 0.5
273 0.53
274 0.46
275 0.41
276 0.38
277 0.35
278 0.34
279 0.32
280 0.25
281 0.2
282 0.19
283 0.19
284 0.2
285 0.19
286 0.18
287 0.22
288 0.26
289 0.27
290 0.29
291 0.31
292 0.34
293 0.32
294 0.34
295 0.32
296 0.29
297 0.3
298 0.34
299 0.34
300 0.32
301 0.31
302 0.32
303 0.3