Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JXH1

Protein Details
Accession C4JXH1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
18-37WRLSSMQKARQRKRLRAVDQHydrophilic
74-103DKYTIFDRKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
81-95RKEKKYRKGIHKLPK
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG ure:UREG_06344  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPVMGGLLWKIPWRLSSMQKARQRKRLRAVDQVVDTVSAALKRNGGVTTKAVERWYKEMPREEEMLPKDKYTIFDRKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.15
5 0.19
6 0.23
7 0.27
8 0.37
9 0.44
10 0.52
11 0.6
12 0.69
13 0.72
14 0.77
15 0.8
16 0.78
17 0.8
18 0.81
19 0.78
20 0.77
21 0.75
22 0.7
23 0.62
24 0.54
25 0.43
26 0.33
27 0.27
28 0.17
29 0.13
30 0.08
31 0.08
32 0.08
33 0.08
34 0.08
35 0.09
36 0.1
37 0.11
38 0.11
39 0.11
40 0.13
41 0.13
42 0.14
43 0.15
44 0.15
45 0.16
46 0.19
47 0.23
48 0.25
49 0.28
50 0.33
51 0.35
52 0.36
53 0.38
54 0.34
55 0.35
56 0.34
57 0.36
58 0.3
59 0.27
60 0.26
61 0.24
62 0.26
63 0.26
64 0.32
65 0.3
66 0.39
67 0.45
68 0.54
69 0.63
70 0.68
71 0.71
72 0.72
73 0.79
74 0.8
75 0.85
76 0.85
77 0.86
78 0.86
79 0.89
80 0.88
81 0.88
82 0.83
83 0.8
84 0.8
85 0.8
86 0.8
87 0.77
88 0.79