Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JNL5

Protein Details
Accession C4JNL5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
80-100ITTERKQKRKVVRELRRQDGRBasic
NLS Segment(s)
PositionSequence
87-89KRK
Subcellular Location(s) cyto 11.5, cyto_nucl 11, nucl 9.5, cysk 4
Family & Domain DBs
KEGG ure:UREG_03013  -  
Amino Acid Sequences MAEVNADDCSLGGLPFGPPTGGAISLTGLENLSSSEKSARIAAVVSDIYASIIFISRHVKAGTLTKHHCKPLYNFMDNIITTERKQKRKVVRELRRQDGRMERMASRHQRDVEKLLGLARSAIMHLRRSMERLQMELDELKGKRRIDLGDIEKRLPVKMADETGPVGTDELKNGAEEVACPGDKQVEDECRVRSPLNPDVSETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.07
5 0.07
6 0.09
7 0.1
8 0.1
9 0.09
10 0.09
11 0.09
12 0.1
13 0.11
14 0.09
15 0.08
16 0.07
17 0.07
18 0.08
19 0.1
20 0.09
21 0.1
22 0.12
23 0.12
24 0.14
25 0.15
26 0.14
27 0.12
28 0.12
29 0.11
30 0.11
31 0.11
32 0.09
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.04
39 0.06
40 0.06
41 0.08
42 0.11
43 0.11
44 0.14
45 0.14
46 0.15
47 0.14
48 0.21
49 0.24
50 0.29
51 0.34
52 0.38
53 0.43
54 0.46
55 0.47
56 0.44
57 0.44
58 0.47
59 0.5
60 0.44
61 0.4
62 0.38
63 0.39
64 0.35
65 0.32
66 0.24
67 0.17
68 0.15
69 0.25
70 0.31
71 0.34
72 0.38
73 0.45
74 0.52
75 0.61
76 0.71
77 0.72
78 0.75
79 0.79
80 0.83
81 0.83
82 0.79
83 0.7
84 0.65
85 0.61
86 0.54
87 0.47
88 0.42
89 0.34
90 0.31
91 0.37
92 0.39
93 0.35
94 0.36
95 0.35
96 0.35
97 0.36
98 0.37
99 0.32
100 0.25
101 0.22
102 0.19
103 0.16
104 0.14
105 0.12
106 0.08
107 0.07
108 0.06
109 0.09
110 0.1
111 0.11
112 0.12
113 0.15
114 0.16
115 0.19
116 0.21
117 0.25
118 0.23
119 0.23
120 0.23
121 0.2
122 0.21
123 0.19
124 0.17
125 0.16
126 0.16
127 0.19
128 0.23
129 0.23
130 0.23
131 0.25
132 0.26
133 0.24
134 0.32
135 0.35
136 0.39
137 0.41
138 0.4
139 0.39
140 0.38
141 0.35
142 0.28
143 0.21
144 0.15
145 0.16
146 0.18
147 0.18
148 0.19
149 0.2
150 0.18
151 0.18
152 0.15
153 0.12
154 0.11
155 0.1
156 0.1
157 0.11
158 0.11
159 0.1
160 0.11
161 0.11
162 0.09
163 0.09
164 0.12
165 0.14
166 0.14
167 0.13
168 0.14
169 0.17
170 0.17
171 0.2
172 0.23
173 0.26
174 0.3
175 0.34
176 0.36
177 0.35
178 0.38
179 0.36
180 0.34
181 0.34
182 0.38
183 0.43
184 0.41