Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2J3D4

Protein Details
Accession A0A0A2J3D4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
410-432IWSPGLAARRRNREIKRRPAMWGHydrophilic
NLS Segment(s)
PositionSequence
418-427RRRNREIKRR
Subcellular Location(s) nucl 18, cyto_nucl 11.833, cyto_mito 3.666, cyto 3.5, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002993  ODC_AZ  
IPR034751  Yippee  
IPR004910  Yippee/Mis18/Cereblon  
IPR039058  Yippee_fam  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0008073  F:ornithine decarboxylase inhibitor activity  
Pfam View protein in Pfam  
PF02100  ODC_AZ  
PF03226  Yippee-Mis18  
PROSITE View protein in PROSITE  
PS51792  YIPPEE  
Amino Acid Sequences MQRFLDQDSQSTVLATCYSVEPSTSKVHGFHYCTTLGAGKYLGYSGIPEVPSGTKSSLLSPPHDILDSRAERTWPGNRPEYKGEATHNIPEECERLFCDKLSATFLGERNSVRQESLGMDVYQNIQSNQIRHQHDRIQRWIEVWDYSSDAIYRGFVAEHNKERTLFVFFEDRALEHGLKSGATITFTFIHLDIPSNLEKPLRMSKDRVKTLQFPKFLLPSVFSTKPSAGLSPTDHRPQNTKTEKYLDGHVSYLRCAGCASHLCWTSQIISKGFTGRHGRAYLVSAEPVATAVSVSASSSPTASLPNTILQRPVPRQLVTGAHTVSDVSCTFCDSVLGWKYVAAEEESQRYKVGKFILETKKIAASSCWESPPGVDRTMQADHPYEIESGPADTEFDSQDEDECEDLFAGIWSPGLAARRRNREIKRRPAMWGIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.12
4 0.11
5 0.13
6 0.13
7 0.14
8 0.14
9 0.17
10 0.22
11 0.23
12 0.24
13 0.23
14 0.28
15 0.34
16 0.38
17 0.38
18 0.36
19 0.35
20 0.33
21 0.33
22 0.32
23 0.25
24 0.21
25 0.18
26 0.14
27 0.14
28 0.14
29 0.12
30 0.08
31 0.09
32 0.1
33 0.14
34 0.14
35 0.13
36 0.15
37 0.16
38 0.17
39 0.19
40 0.18
41 0.16
42 0.17
43 0.21
44 0.25
45 0.27
46 0.29
47 0.31
48 0.32
49 0.31
50 0.31
51 0.27
52 0.24
53 0.31
54 0.3
55 0.28
56 0.28
57 0.27
58 0.27
59 0.32
60 0.37
61 0.35
62 0.39
63 0.45
64 0.47
65 0.52
66 0.56
67 0.56
68 0.51
69 0.46
70 0.44
71 0.41
72 0.41
73 0.4
74 0.39
75 0.34
76 0.32
77 0.3
78 0.28
79 0.22
80 0.2
81 0.17
82 0.18
83 0.18
84 0.18
85 0.19
86 0.19
87 0.19
88 0.23
89 0.21
90 0.18
91 0.22
92 0.23
93 0.23
94 0.24
95 0.23
96 0.22
97 0.26
98 0.25
99 0.2
100 0.19
101 0.17
102 0.17
103 0.19
104 0.18
105 0.14
106 0.14
107 0.14
108 0.16
109 0.17
110 0.16
111 0.13
112 0.17
113 0.19
114 0.2
115 0.25
116 0.31
117 0.34
118 0.37
119 0.42
120 0.45
121 0.51
122 0.55
123 0.57
124 0.54
125 0.5
126 0.47
127 0.43
128 0.36
129 0.29
130 0.24
131 0.17
132 0.14
133 0.13
134 0.12
135 0.11
136 0.1
137 0.09
138 0.08
139 0.07
140 0.06
141 0.06
142 0.08
143 0.13
144 0.18
145 0.23
146 0.26
147 0.27
148 0.28
149 0.28
150 0.27
151 0.26
152 0.21
153 0.17
154 0.18
155 0.17
156 0.18
157 0.17
158 0.16
159 0.15
160 0.17
161 0.15
162 0.11
163 0.13
164 0.11
165 0.11
166 0.1
167 0.1
168 0.07
169 0.08
170 0.08
171 0.09
172 0.1
173 0.1
174 0.11
175 0.09
176 0.1
177 0.09
178 0.1
179 0.09
180 0.1
181 0.11
182 0.11
183 0.11
184 0.11
185 0.11
186 0.13
187 0.2
188 0.22
189 0.23
190 0.28
191 0.35
192 0.44
193 0.48
194 0.48
195 0.44
196 0.48
197 0.54
198 0.56
199 0.5
200 0.42
201 0.4
202 0.38
203 0.36
204 0.28
205 0.21
206 0.17
207 0.21
208 0.21
209 0.2
210 0.2
211 0.19
212 0.21
213 0.19
214 0.17
215 0.12
216 0.13
217 0.15
218 0.17
219 0.21
220 0.24
221 0.25
222 0.25
223 0.29
224 0.3
225 0.37
226 0.4
227 0.4
228 0.38
229 0.41
230 0.43
231 0.4
232 0.42
233 0.34
234 0.28
235 0.26
236 0.25
237 0.21
238 0.18
239 0.2
240 0.15
241 0.12
242 0.11
243 0.1
244 0.12
245 0.14
246 0.15
247 0.17
248 0.18
249 0.18
250 0.19
251 0.2
252 0.19
253 0.2
254 0.22
255 0.17
256 0.18
257 0.19
258 0.21
259 0.2
260 0.24
261 0.26
262 0.25
263 0.29
264 0.28
265 0.27
266 0.25
267 0.27
268 0.23
269 0.18
270 0.17
271 0.12
272 0.11
273 0.1
274 0.09
275 0.07
276 0.05
277 0.04
278 0.03
279 0.04
280 0.04
281 0.04
282 0.05
283 0.06
284 0.06
285 0.06
286 0.07
287 0.07
288 0.09
289 0.09
290 0.1
291 0.1
292 0.15
293 0.17
294 0.18
295 0.19
296 0.2
297 0.27
298 0.29
299 0.34
300 0.34
301 0.31
302 0.32
303 0.33
304 0.35
305 0.3
306 0.31
307 0.24
308 0.2
309 0.2
310 0.19
311 0.16
312 0.14
313 0.12
314 0.1
315 0.09
316 0.11
317 0.11
318 0.11
319 0.12
320 0.1
321 0.17
322 0.18
323 0.19
324 0.17
325 0.18
326 0.19
327 0.19
328 0.19
329 0.14
330 0.14
331 0.15
332 0.22
333 0.23
334 0.23
335 0.24
336 0.24
337 0.22
338 0.23
339 0.25
340 0.22
341 0.22
342 0.32
343 0.4
344 0.44
345 0.44
346 0.43
347 0.43
348 0.4
349 0.38
350 0.29
351 0.26
352 0.26
353 0.29
354 0.28
355 0.25
356 0.25
357 0.26
358 0.31
359 0.28
360 0.24
361 0.21
362 0.21
363 0.25
364 0.28
365 0.28
366 0.25
367 0.25
368 0.24
369 0.24
370 0.24
371 0.2
372 0.17
373 0.16
374 0.13
375 0.11
376 0.11
377 0.1
378 0.09
379 0.09
380 0.11
381 0.11
382 0.11
383 0.12
384 0.12
385 0.13
386 0.14
387 0.15
388 0.14
389 0.13
390 0.13
391 0.11
392 0.1
393 0.09
394 0.08
395 0.07
396 0.07
397 0.07
398 0.06
399 0.06
400 0.09
401 0.14
402 0.18
403 0.26
404 0.35
405 0.45
406 0.52
407 0.62
408 0.7
409 0.76
410 0.83
411 0.85
412 0.86
413 0.8
414 0.79