Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TLS9

Protein Details
Accession A7TLS9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
71-100AGKVKVPKDKSKKADKPKVKRKQKAVPIEYBasic
NLS Segment(s)
PositionSequence
73-94KVKVPKDKSKKADKPKVKRKQK
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029021  Prot-tyrosine_phosphatase-like  
IPR004861  Siw14-like  
KEGG vpo:Kpol_526p24  -  
Pfam View protein in Pfam  
PF03162  Y_phosphatase2  
CDD cd17663  PFA-DSP_Oca6  
Amino Acid Sequences MSTFVTPLQFSTVQPNLYRGSYPREINLPFIETLNLKNVISLTPKAIDSESDGSLTNFCNANNINLIHIQAGKVKVPKDKSKKADKPKVKRKQKAVPIEYDTVIQCIRVLIDKNNYPCYIHGATDNDMITSLIVACLRKLSFWSNIAIINEYLTYNSSINIHERNFIENFNSEITIDNTKLKDKVPWIHMQSITNTNKTLPKLVFEQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.29
4 0.29
5 0.3
6 0.25
7 0.29
8 0.32
9 0.33
10 0.32
11 0.36
12 0.35
13 0.37
14 0.37
15 0.32
16 0.26
17 0.25
18 0.24
19 0.19
20 0.19
21 0.2
22 0.19
23 0.16
24 0.16
25 0.16
26 0.16
27 0.19
28 0.19
29 0.16
30 0.16
31 0.17
32 0.17
33 0.17
34 0.16
35 0.16
36 0.19
37 0.17
38 0.16
39 0.16
40 0.15
41 0.16
42 0.16
43 0.14
44 0.11
45 0.1
46 0.13
47 0.13
48 0.15
49 0.17
50 0.16
51 0.15
52 0.15
53 0.16
54 0.13
55 0.13
56 0.12
57 0.12
58 0.13
59 0.14
60 0.17
61 0.19
62 0.23
63 0.29
64 0.38
65 0.44
66 0.52
67 0.57
68 0.65
69 0.72
70 0.78
71 0.82
72 0.83
73 0.84
74 0.87
75 0.9
76 0.9
77 0.88
78 0.86
79 0.85
80 0.84
81 0.83
82 0.76
83 0.71
84 0.64
85 0.58
86 0.5
87 0.42
88 0.32
89 0.23
90 0.19
91 0.13
92 0.08
93 0.06
94 0.06
95 0.07
96 0.08
97 0.09
98 0.14
99 0.17
100 0.2
101 0.23
102 0.23
103 0.22
104 0.21
105 0.24
106 0.21
107 0.18
108 0.18
109 0.18
110 0.19
111 0.21
112 0.2
113 0.14
114 0.13
115 0.12
116 0.1
117 0.08
118 0.06
119 0.04
120 0.05
121 0.05
122 0.05
123 0.08
124 0.08
125 0.08
126 0.1
127 0.13
128 0.16
129 0.17
130 0.19
131 0.17
132 0.2
133 0.2
134 0.2
135 0.16
136 0.13
137 0.12
138 0.11
139 0.1
140 0.09
141 0.1
142 0.08
143 0.09
144 0.1
145 0.11
146 0.14
147 0.18
148 0.18
149 0.21
150 0.21
151 0.25
152 0.24
153 0.24
154 0.23
155 0.2
156 0.21
157 0.18
158 0.17
159 0.14
160 0.14
161 0.16
162 0.17
163 0.17
164 0.2
165 0.2
166 0.23
167 0.25
168 0.24
169 0.27
170 0.3
171 0.37
172 0.39
173 0.46
174 0.48
175 0.54
176 0.56
177 0.53
178 0.51
179 0.53
180 0.51
181 0.45
182 0.4
183 0.36
184 0.38
185 0.38
186 0.41
187 0.32
188 0.32