Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2JCA7

Protein Details
Accession A0A0A2JCA7    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSSRLARDRKEKGERKRDEAQGBasic
NLS Segment(s)
PositionSequence
8-17DRKEKGERKR
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSSRLARDRKEKGERKRDEAQGKEEQRRHDYVKFMAEGLKTAFDLDRRSESPRERQAPPASDPPPAAAVKKTPAAPPPTINRLPVEITPGLRPPARPVDKNPGATNNGPVDNLPGPPADMIPARPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.8
4 0.8
5 0.78
6 0.74
7 0.7
8 0.69
9 0.7
10 0.72
11 0.67
12 0.63
13 0.6
14 0.59
15 0.58
16 0.51
17 0.48
18 0.41
19 0.42
20 0.36
21 0.32
22 0.3
23 0.25
24 0.22
25 0.19
26 0.16
27 0.12
28 0.12
29 0.12
30 0.1
31 0.12
32 0.13
33 0.17
34 0.17
35 0.22
36 0.26
37 0.29
38 0.36
39 0.43
40 0.46
41 0.43
42 0.48
43 0.49
44 0.48
45 0.47
46 0.46
47 0.38
48 0.35
49 0.33
50 0.27
51 0.25
52 0.22
53 0.19
54 0.12
55 0.13
56 0.13
57 0.16
58 0.16
59 0.15
60 0.2
61 0.23
62 0.24
63 0.27
64 0.3
65 0.35
66 0.35
67 0.34
68 0.3
69 0.28
70 0.28
71 0.24
72 0.24
73 0.18
74 0.18
75 0.19
76 0.2
77 0.2
78 0.2
79 0.2
80 0.2
81 0.3
82 0.34
83 0.35
84 0.39
85 0.47
86 0.53
87 0.57
88 0.54
89 0.49
90 0.49
91 0.47
92 0.46
93 0.39
94 0.34
95 0.3
96 0.27
97 0.26
98 0.23
99 0.22
100 0.18
101 0.14
102 0.14
103 0.14
104 0.14
105 0.12
106 0.13