Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2K0F8

Protein Details
Accession A0A0A2K0F8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-23AFQAAKRDLRKRMRSTLQNLPIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002698  FTHF_cligase  
IPR024185  FTHF_cligase-like_sf  
IPR037171  NagB/RpiA_transferase-like  
Gene Ontology GO:0030272  F:5-formyltetrahydrofolate cyclo-ligase activity  
GO:0005524  F:ATP binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01812  5-FTHF_cyc-lig  
Amino Acid Sequences MAFQAAKRDLRKRMRSTLQNLPITSISQQSSAATTRFLSLPEYQNAKSIAVYLSMPSGELSTTGIVKDALQRGKNVYIPYIHTQDKTSIMDMFALGSMSEFESLQLDKWGIPSLLSTQIEGRPNGLTQGLDLIVMPGMAFDRGFRRLGHGKGYYDHFLTRYSTSTRKMPFLVALSLQDQLLAEDIPVVEHDWLVDAIVVGDGQFFDRRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.8
4 0.8
5 0.79
6 0.75
7 0.67
8 0.61
9 0.52
10 0.44
11 0.39
12 0.32
13 0.24
14 0.19
15 0.19
16 0.16
17 0.17
18 0.18
19 0.17
20 0.14
21 0.14
22 0.15
23 0.15
24 0.15
25 0.15
26 0.18
27 0.22
28 0.26
29 0.3
30 0.28
31 0.31
32 0.32
33 0.29
34 0.24
35 0.21
36 0.16
37 0.13
38 0.13
39 0.1
40 0.09
41 0.09
42 0.09
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.07
50 0.06
51 0.07
52 0.07
53 0.07
54 0.12
55 0.16
56 0.2
57 0.21
58 0.22
59 0.24
60 0.27
61 0.29
62 0.25
63 0.22
64 0.19
65 0.22
66 0.24
67 0.26
68 0.25
69 0.23
70 0.23
71 0.23
72 0.24
73 0.21
74 0.19
75 0.15
76 0.13
77 0.13
78 0.11
79 0.1
80 0.07
81 0.06
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.05
95 0.06
96 0.07
97 0.06
98 0.06
99 0.06
100 0.08
101 0.13
102 0.13
103 0.13
104 0.13
105 0.17
106 0.19
107 0.19
108 0.18
109 0.14
110 0.14
111 0.14
112 0.13
113 0.09
114 0.07
115 0.08
116 0.07
117 0.06
118 0.06
119 0.05
120 0.05
121 0.05
122 0.04
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.07
129 0.1
130 0.11
131 0.11
132 0.18
133 0.23
134 0.25
135 0.31
136 0.32
137 0.31
138 0.33
139 0.37
140 0.33
141 0.29
142 0.28
143 0.22
144 0.21
145 0.22
146 0.2
147 0.19
148 0.21
149 0.24
150 0.27
151 0.33
152 0.34
153 0.35
154 0.35
155 0.33
156 0.32
157 0.3
158 0.29
159 0.23
160 0.23
161 0.2
162 0.2
163 0.18
164 0.15
165 0.12
166 0.1
167 0.1
168 0.07
169 0.06
170 0.06
171 0.06
172 0.06
173 0.07
174 0.08
175 0.07
176 0.07
177 0.07
178 0.08
179 0.08
180 0.08
181 0.07
182 0.06
183 0.06
184 0.06
185 0.06
186 0.04
187 0.05
188 0.05
189 0.07