Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2KW03

Protein Details
Accession A0A0A2KW03   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
187-221GNIRGISRTERKERIRRNERKQRSNEKRSNPARAKBasic
NLS Segment(s)
PositionSequence
101-140KPLPVPKAPTKWELFARKKGIGKFSQKPGAAGQDKERRKK
189-221IRGISRTERKERIRRNERKQRSNEKRSNPARAK
Subcellular Location(s) cyto 10.5cyto_nucl 10.5, nucl 9.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSDTEMANSAPAAGSKIERLPITVSKPTPYTFDLGHLLVNDPNPLELPADQTLNDSLKATARDGVQVLINQLLTTCEIKTSVADGVLLTLPAPNIHLPRHKPLPVPKAPTKWELFARKKGIGKFSQKPGAAGQDKERRKKLQYDEATGEWVPRWGYKGKNKDDENQWLVEVDEKKWKKEAEANAEGGNIRGISRTERKERIRRNERKQRSNEKRSNPARAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.15
4 0.18
5 0.18
6 0.2
7 0.22
8 0.26
9 0.31
10 0.35
11 0.34
12 0.34
13 0.37
14 0.36
15 0.35
16 0.32
17 0.29
18 0.23
19 0.24
20 0.24
21 0.22
22 0.22
23 0.18
24 0.18
25 0.17
26 0.17
27 0.14
28 0.11
29 0.11
30 0.11
31 0.11
32 0.11
33 0.09
34 0.13
35 0.13
36 0.14
37 0.14
38 0.15
39 0.16
40 0.16
41 0.16
42 0.13
43 0.12
44 0.14
45 0.15
46 0.15
47 0.15
48 0.15
49 0.16
50 0.16
51 0.16
52 0.14
53 0.13
54 0.13
55 0.11
56 0.11
57 0.08
58 0.08
59 0.08
60 0.08
61 0.09
62 0.08
63 0.07
64 0.08
65 0.08
66 0.08
67 0.09
68 0.08
69 0.07
70 0.07
71 0.06
72 0.07
73 0.07
74 0.07
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.08
82 0.11
83 0.16
84 0.19
85 0.24
86 0.3
87 0.31
88 0.34
89 0.4
90 0.47
91 0.47
92 0.51
93 0.51
94 0.51
95 0.51
96 0.51
97 0.45
98 0.39
99 0.39
100 0.42
101 0.42
102 0.43
103 0.45
104 0.44
105 0.47
106 0.46
107 0.46
108 0.43
109 0.46
110 0.45
111 0.47
112 0.49
113 0.45
114 0.44
115 0.4
116 0.41
117 0.36
118 0.31
119 0.34
120 0.36
121 0.42
122 0.47
123 0.51
124 0.48
125 0.49
126 0.56
127 0.55
128 0.57
129 0.56
130 0.56
131 0.54
132 0.5
133 0.49
134 0.41
135 0.34
136 0.24
137 0.2
138 0.14
139 0.11
140 0.13
141 0.14
142 0.22
143 0.3
144 0.4
145 0.46
146 0.54
147 0.57
148 0.61
149 0.64
150 0.66
151 0.6
152 0.51
153 0.43
154 0.35
155 0.32
156 0.3
157 0.25
158 0.18
159 0.26
160 0.26
161 0.28
162 0.33
163 0.33
164 0.32
165 0.38
166 0.45
167 0.44
168 0.48
169 0.48
170 0.44
171 0.44
172 0.4
173 0.32
174 0.24
175 0.15
176 0.1
177 0.09
178 0.1
179 0.15
180 0.24
181 0.31
182 0.38
183 0.47
184 0.57
185 0.66
186 0.75
187 0.8
188 0.83
189 0.87
190 0.89
191 0.92
192 0.93
193 0.93
194 0.93
195 0.93
196 0.93
197 0.94
198 0.92
199 0.9
200 0.9
201 0.88