Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A2KPB6

Protein Details
Accession A0A0A2KPB6   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
147-176LEAEKEKKARSLKKKLRQARDLRDKKQHGEBasic
NLS Segment(s)
PositionSequence
98-105AKRREAKR
151-172KEKKARSLKKKLRQARDLRDKK
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MASNVARSGITTDAQTGERYIPSSIRADGSKRKEIRVRPGYKPPEDVELYKHRAAATWKTRGKGGVPGAEALSSEDDKTKTAAKPTLTAATAASNKNAKRREAKRNAKESDETGPAVEGKGAESNNWRVPAPTPKKEEKPTEEPVDLEAEKEKKARSLKKKLRQARDLRDKKQHGEALLPEQLEKVIKIQELVRQLDVLGFDSNGDKKNGDSNENPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.16
5 0.16
6 0.17
7 0.17
8 0.16
9 0.17
10 0.19
11 0.19
12 0.2
13 0.22
14 0.26
15 0.34
16 0.4
17 0.46
18 0.47
19 0.52
20 0.57
21 0.61
22 0.66
23 0.68
24 0.68
25 0.65
26 0.73
27 0.74
28 0.7
29 0.67
30 0.58
31 0.54
32 0.5
33 0.44
34 0.4
35 0.39
36 0.42
37 0.38
38 0.38
39 0.31
40 0.31
41 0.34
42 0.37
43 0.36
44 0.41
45 0.43
46 0.43
47 0.44
48 0.43
49 0.4
50 0.38
51 0.34
52 0.29
53 0.26
54 0.26
55 0.25
56 0.23
57 0.22
58 0.15
59 0.13
60 0.09
61 0.09
62 0.1
63 0.1
64 0.11
65 0.12
66 0.15
67 0.15
68 0.19
69 0.22
70 0.21
71 0.23
72 0.24
73 0.26
74 0.22
75 0.21
76 0.17
77 0.17
78 0.19
79 0.17
80 0.17
81 0.19
82 0.2
83 0.26
84 0.29
85 0.29
86 0.36
87 0.43
88 0.52
89 0.59
90 0.68
91 0.7
92 0.76
93 0.75
94 0.69
95 0.62
96 0.53
97 0.46
98 0.37
99 0.28
100 0.19
101 0.17
102 0.14
103 0.12
104 0.1
105 0.06
106 0.05
107 0.07
108 0.07
109 0.08
110 0.11
111 0.14
112 0.17
113 0.18
114 0.17
115 0.16
116 0.19
117 0.28
118 0.34
119 0.37
120 0.4
121 0.46
122 0.52
123 0.58
124 0.63
125 0.59
126 0.59
127 0.58
128 0.57
129 0.51
130 0.45
131 0.39
132 0.36
133 0.29
134 0.22
135 0.2
136 0.17
137 0.18
138 0.2
139 0.19
140 0.21
141 0.29
142 0.39
143 0.45
144 0.55
145 0.64
146 0.72
147 0.82
148 0.86
149 0.87
150 0.88
151 0.87
152 0.87
153 0.88
154 0.87
155 0.84
156 0.85
157 0.8
158 0.74
159 0.72
160 0.65
161 0.55
162 0.5
163 0.45
164 0.41
165 0.39
166 0.35
167 0.27
168 0.23
169 0.23
170 0.19
171 0.17
172 0.13
173 0.13
174 0.13
175 0.15
176 0.17
177 0.21
178 0.26
179 0.29
180 0.27
181 0.24
182 0.24
183 0.23
184 0.22
185 0.19
186 0.14
187 0.11
188 0.11
189 0.14
190 0.17
191 0.18
192 0.19
193 0.17
194 0.18
195 0.26
196 0.29
197 0.31