Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A2L7D5

Protein Details
Accession A0A0A2L7D5    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-28STLSRVKQEQLRKRRNNLLRRHNDFWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito_nucl 14.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MTSTLSRVKQEQLRKRRNNLLRRHNDFWRLYAIRSWLIMEMPNKRIYTYSSHPEMPAPTREQMVGSGFRKRTTFGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.83
4 0.85
5 0.84
6 0.84
7 0.84
8 0.83
9 0.83
10 0.8
11 0.74
12 0.73
13 0.64
14 0.56
15 0.52
16 0.43
17 0.35
18 0.32
19 0.29
20 0.22
21 0.21
22 0.2
23 0.12
24 0.11
25 0.13
26 0.13
27 0.15
28 0.17
29 0.2
30 0.2
31 0.2
32 0.2
33 0.2
34 0.24
35 0.25
36 0.29
37 0.28
38 0.29
39 0.3
40 0.31
41 0.32
42 0.28
43 0.28
44 0.26
45 0.24
46 0.24
47 0.24
48 0.23
49 0.22
50 0.22
51 0.25
52 0.24
53 0.31
54 0.31
55 0.34
56 0.34